Solution structure of the PDZ domain from human FERM and PDZ domain containing 1. Determined by solution NMR. Released 21 Aug 2007.
Explore 2EDV in 3D Show helices and sheets RCSB PDB PDBe
2EDV contains 1 α-helix and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-14 | 7 | 1 |
| β-strand | 25 | 1 | 2 |
| β-strand | 34 | 1 | 3 |
| β-strand | 38 | 1 | 2 |
| β-strand | 53 | 1 | 3 |
| β-strand | 54-57 | 4 | 1 |
| β-strand | 61 | 1 | 1 |
| α-helix | 67-76 | 10 | |
| β-strand | 81-87 | 7 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| FERM and PDZ domain-containing protein 1 | A | protein | 96 | Homo sapiens | Q5SYB0 (AlphaFold model) |
>2EDV_1 FERM and PDZ domain-containing protein 1 (chains A) GSSGSSGVRHTVKIDKDTLLQDYGFHISESLPLTVVAVTAGGSAHGKLFPGDQILQMNNE PAEDLSWERAVDILREAEDSLSITVVRCTSSGPSSG
Solution structure of the PDZ domain from human FERM and PDZ domain containing 1. Seimiya, K., Kurosaki, C., Yoshida, M. et al. To be published.
Other PDB entries of the same protein (UniProt Q5SYB0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2EDV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.