2EHB: C-terminal domain of the protein kinase AtSOS2

The structure of the C-terminal domain of the protein kinase AtSOS2 bound to the calcium sensor AtSOS3. Determined by X-ray diffraction at 2.1 Å resolution. Released 25 Sept 2007.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Arabidopsis thaliana
Chains: 2
Atoms: 2,725
Mol. weight: 40.49 kDa
Ligands: CA
Released: 25 Sept 2007

Explore 2EHB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2EHB contains 18 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	21-27	7
α-helix	32-45	14
β-strand	55-56	2	1
α-helix	57-65	9
α-helix	73-82	10
β-strand	89-90	2	1
α-helix	92-99	8
α-helix	100-102	3
α-helix	108-119	12
β-strand	127-128	2	2
α-helix	129-143	15
α-helix	149-163	15
β-strand	170-171	2	2
α-helix	173-182	10
α-helix	184-190	7

Chain D: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	307	1
β-strand	308-309	2	3
α-helix	312-316	5
α-helix	324-328	5
α-helix	335-337	3
β-strand	340-343	4	3
α-helix	347-360	14
β-strand	363-367	5	3
β-strand	371-376	6	3
α-helix	381-383	3
β-strand	386-395	10	3
β-strand	398-407	10	3
α-helix	410-423	14
β-strand	428	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcineurin B-like protein 4	A	protein	207	Arabidopsis thaliana	O81223 (AlphaFold model)
CBL-interacting serine/threonine-protein kinase 24	D	protein	143	Arabidopsis thaliana	Q9LDI3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2EHB_1 Calcineurin B-like protein 4 (chains A)
MGCSVSKKKKKNAMRPPGYEDPELLASVTPFTVEEVEALYELFKKLSSSIIDDGLIHKEE
FQLALFRNRNRRNLFADRIFDVFDVKRNGVIEFGEFVRSLGVFHPSAPVHEKVKFAFKLY
DLRQTGFIEREELKEMVVALLHESELVLSEDMIEVMVDKAFVQADRKNDGKIDIDEWKDF
VSLNPSLIKNMTLPYLKDINRTFPSFV

Sequence of entity 2 (D), FASTA

>2EHB_2 CBL-interacting serine/threonine-protein kinase 24 (chains D)
DEGPLMMNAFEMITLSQGLNLSALFDRRQDFVKRQTRFVSRREPSEIIANIEAVANSMGF
KSHTRNFKTRLEGLSSIKAGQLAVVIEIYEVAPSLFMVDVRKAAGETLEYHKFYKKLCSK
LENIIWRATEGIPKSEILRTITF

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Primary citation

The structure of the C-terminal domain of the protein kinase AtSOS2 bound to the calcium sensor AtSOS3. Sanchez-Barrena, M.J., Fujii, H., Angulo, I. et al. Mol Cell (2007) 26:427-435. DOI 10.1016/j.molcel.2007.04.013 · PubMed

Other PDB entries of the same protein (UniProt O81223 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5O9U 1.85 Å, HsNMT1 in complex with CoA and Myristoylated-GCSVSKKK octapeptide
1V1G 2.7 Å, Structure of the Arabidopsis thaliana SOS3 complexed with Calcium(II) ion
1V1F 3.0 Å, Structure of the Arabidopsis thaliana SOS3 complexed with Calcium(II) and Manganese(II)…

Browse structure collections

About this viewer

MolViewer shows 2EHB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.