Solution structure of the SWIRM domain of baker's yeast Transcriptional adapter 2. Determined by solution NMR. Released 2 Oct 2007.
Explore 2ELJ in 3D Show helices and sheets RCSB PDB PDBe
2ELJ contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12-15 | 4 | |
| α-helix | 25-30 | 6 | |
| α-helix | 31-35 | 5 | |
| α-helix | 38-55 | 18 | |
| α-helix | 61-67 | 7 | |
| α-helix | 72-84 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transcriptional adapter 2 | A | protein | 88 | Saccharomyces cerevisiae | Q02336 (AlphaFold model) |
>2ELJ_1 Transcriptional adapter 2 (chains A) GSSGSSGNMTISDIQHAPDYALLSNDEQQLCIQLKILPKPYLVLKEVMFRELLKTGGNLS KSACRELLNIDPIKANRIYDFFQSQNWM
Solution structure of the SWIRM domain of baker's yeast Transcriptional adapter 2. Yoneyama, M., Tochio, N., Koshiba, S. et al. To be published.
Other PDB entries of the same protein (UniProt Q02336 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2ELJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.