2ERS: Interleukin-15 receptor sushi domain

Solution structure of the Interleukin-15 receptor sushi domain. Determined by solution NMR. Released 7 Feb 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 520
Mol. weight: 7.47 kDa
Released: 7 Feb 2006

Explore 2ERS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ERS contains 0 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	54-56	3	1
β-strand	64-65	2	2
β-strand	72-74	3	1
β-strand	75-77	3	3
β-strand	84-86	3	3
β-strand	93-94	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-15 receptor alpha chain	A	protein	66	Homo sapiens	Q13261 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2ERS_1 Interleukin-15 receptor alpha chain (chains A)
ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPS
LKCIRD

Primary citation

The structure of the interleukin-15 alpha receptor and its implications for ligand binding. Lorenzen, I., Dingley, A.J., Jacques, Y. et al. J Biol Chem (2006) 281:6642-6647. DOI 10.1074/jbc.M513118200 · PubMed

Other PDB entries of the same protein (UniProt Q13261 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Z3Q 1.85 Å, Crystal structure of the IL-15/IL-15Ra complex
2Z3R 2.0 Å, Crystal structure of the IL-15/IL-15Ra complex
4GS7 2.35 Å, Structure of the Interleukin-15 quaternary complex

Browse structure collections

About this viewer

MolViewer shows 2ERS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.