2EUP: Cytochrome c peroxidase

Cytochrome c peroxidase (CCP) in complex with 2-amino-5-picoline. Determined by X-ray diffraction at 1.4 Å resolution. Released 11 Apr 2006.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 2,735
Mol. weight: 34.18 kDa
Ligands: HEM, LG4
Released: 11 Apr 2006

Explore 2EUP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2EUP contains 24 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	1
α-helix	10-11	2
α-helix	16-32	17
α-helix	36-39	4
α-helix	43-54	12
β-strand	58	1	2
β-strand	63	1	2
α-helix	70-72	3
α-helix	74-77	4
α-helix	80-82	3
α-helix	86-98	13
α-helix	104-118	15
β-strand	126	1	3
α-helix	135-137	3
α-helix	138-140	3
α-helix	145-146	2
α-helix	151-159	9
α-helix	165-172	8
α-helix	173-176	4
β-strand	180	1	4
α-helix	182-185	4
β-strand	189	1	4
α-helix	201-208	8
β-strand	211-215	5	5
β-strand	221-225	5	5
β-strand	230-231	2	5
α-helix	233-240	8
α-helix	242-253	12
α-helix	255-271	17
β-strand	274-275	2	1
α-helix	276-277	2
α-helix	281-283	3
β-strand	284	1	3
α-helix	286-288	3
α-helix	289-292	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cytochrome c peroxidase	A	protein	294	Saccharomyces cerevisiae	P00431 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2EUP_1 cytochrome c peroxidase (chains A)
MKTLVHVASVEKGRSYEDFQKVYNAIALKLREDDEYDNYIGYGPVLVRLAWHISGTWDKH
DNTGGSYGGTYRFKKEFNDPSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQ
GPKIPWRCGRVDTPEDTTPDNGRLPDADKDAGYVRTFFQRLNMNDREVVALMGAHALGKT
HLKNSGYEGPGGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGYMMLPTDYSLIQ
DPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKDAPSPFIFKTLEEQGL

Ligands and cofactors

ID	Name	Formula	Copies
HEM	Protoporphyrin IX containing FE	C34 H32 Fe N4 O4	1
LG4	5-methylpyridin-2-amine	C6 H8 N2	1

Primary citation

Probing molecular docking in a charged model binding site. Brenk, R., Vetter, S.W., Boyce, S.E. et al. J Mol Biol (2006) 357:1449-1470. DOI 10.1016/j.jmb.2006.01.034 · PubMed

Other PDB entries of the same protein (UniProt P00431 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3E2O 1.06 Å, Crystal structure of cytochrome c peroxidase, N184R mutant
7BIU 1.06 Å, XFEL crystal structure of cytochrome c peroxidase compound II
2EUT 1.12 Å, Cytochrome c peroxidase (CCP) in complex with 2-amino-4-picoline
1Z53 1.13 Å, The 1.13 Angstrom Structure of Iron-free Cytochrome c Peroxidase
1ZBY 1.2 Å, High-Resolution Crystal Structure of Native (Resting) Cytochrome c Peroxidase (CcP)
2RBT 1.24 Å, n-methylbenzylamine in complex with Cytochrome C Peroxidase W191G
2Y5A 1.25 Å, Cytochrome c peroxidase (CCP) W191G bound to 3-aminopyridine
1ZBZ 1.29 Å, High-Resolution Crystal Structure of Compound I intermediate of Cytochrome c Peroxidase…
2AS4 1.3 Å, cytochrome c peroxidase in complex with 3-fluorocatechol
2EUQ 1.3 Å, Cytochrome c peroxydase (CCP) in complex with 3-thienylmethylamine
3E2N 1.3 Å, Engineering ascorbate peroxidase activity into cytochrome c peroxidase
2AQD 1.35 Å, cytochrome c peroxidase (CCP) in complex with 2,5-diaminopyridine

Browse structure collections

About this viewer

MolViewer shows 2EUP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.