Making Protein-Protein Interactions Drugable: Discovery of Low-Molecular-Weight Ligands for the AF6 PDZ Domain. Determined by solution NMR. Released 17 Oct 2006.
Explore 2EXG in 3D Show helices and sheets RCSB PDB PDBe
2EXG contains 4 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 11-16 | 6 | 1 |
| β-strand | 25-30 | 6 | 2 |
| β-strand | 33 | 1 | 3 |
| β-strand | 35 | 1 | 3 |
| β-strand | 39-45 | 7 | 2 |
| α-helix | 50-55 | 6 | |
| α-helix | 57-58 | 2 | |
| β-strand | 62-66 | 5 | 1 |
| β-strand | 69 | 1 | 1 |
| α-helix | 76-78 | 3 | |
| α-helix | 80-83 | 4 | |
| β-strand | 89-95 | 7 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Afadin | A | protein | 101 | Homo sapiens | P55196 (AlphaFold model) |
>2EXG_1 Afadin (chains A) GPLGSLRKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAG DQLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIY
| ID | Name | Formula | Copies |
|---|---|---|---|
| STF | (5R)-2-sulfanyl-5-[4-(trifluoromethyl)benzyl]-1,3-thiazol-4-one | C11 H8 F3 N O S2 | 1 |
Discovery of low-molecular-weight ligands for the AF6 PDZ domain. Joshi, M., Vargas, C., Boisguerin, P. et al. Angew Chem Int Ed Engl (2006) 45:3790-3795. DOI 10.1002/anie.200503965 · PubMed
Other PDB entries of the same protein (UniProt P55196 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2EXG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.