2EZB: Phosphotransferase system, enzyme I

Name: PDB 2EZB: Amino terminal domain of enzyme I from escherichia coli, NMR, 14 structures
Published: 1997-08-20
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: phosphotransferase

Amino terminal domain of enzyme I from escherichia coli, NMR, 14 structures. Determined by solution NMR. Released 20 Aug 1997.

Method: Solution NMR
Organism: Escherichia coli
Chains: 1
Atoms: 1,907
Mol. weight: 28.38 kDa
Released: 20 Aug 1997

Explore 2EZB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2EZB contains 10 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	1
β-strand	12-15	4	2
β-strand	16-18	3	1
α-helix	22-24	3
α-helix	33-64	32
α-helix	67-80	14
α-helix	83-95	13
α-helix	100-116	17
α-helix	121-141	21
β-strand	156-160	5	1
α-helix	165-170	6
β-strand	176-181	6	1
β-strand	182	1	3
α-helix	189-196	8
β-strand	201-202	2	1
β-strand	204	1	3
α-helix	208-210	3
β-strand	217-220	4	2
β-strand	227-229	3	2
α-helix	233-248	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphotransferase system, enzyme I	A	protein	259	Escherichia coli	P08839 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2EZB_1 PHOSPHOTRANSFERASE SYSTEM, ENZYME I (chains A)
MISGILASPGIAFGKALLLKEDEIVIDRKKISADQVDQEVERFLSGRAKASAQLETIKTK
AGETFGEEKEAIFEGHIMLLEDEELEQEIIALIKDKHMTADAAAHEVIEGQASALEELDD
EYLKERAADVRDIGKRLLRNILGLKIIDLSAIQDEVILVAADLTPSETAQLNLKKVLGFI
TDAGGRTSHTSIMARSLELPAIVGTGSVTSQVKNDDYLILDAVNNQVYVNPTNEVIDKMR
AVQEQVASEKAELAKLKDR

Primary citation

Defining long range order in NMR structure determination from the dependence of heteronuclear relaxation times on rotational diffusion anisotropy. Tjandra, N., Garrett, D.S., Gronenborn, A.M. et al. Nat Struct Biol (1997) 4:443-449. DOI 10.1038/nsb0697-443 · PubMed

Other PDB entries of the same protein (UniProt P08839 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6V9K 1.9 Å, Crystal structure of the hybrid C-terminal domain of enzyme I of the bacterial…
1ZYM 2.5 Å, Amino terminal domain of enzyme I from escherichia coli
2HWG 2.7 Å, Structure of phosphorylated Enzyme I of the phosphoenolpyruvate:sugar phosphotransferase…
6VU0 3.5 Å, Crystal structure of the C-terminal domain of enzyme I of the bacterial…
1EZA Amino terminal domain of enzyme I from escherichia coli NMR, restrained regularized mean…
1EZB Amino terminal domain of enzyme I from escherichia coli, NMR, 17 structures
1EZC Amino terminal domain of enzyme I from escherichia coli, NMR, 17 structures
1EZD Amino terminal domain of enzyme I from escherichia coli NMR, 16 structures
2EZA Amino terminal domain of enzyme I from escherichia coli, NMR, restrained regularized…
2EZC Amino terminal domain of enzyme I from escherichia coli, NMR, 14 structures
2KX9 Solution Structure of the Enzyme I dimer Using Residual Dipolar Couplings and Small…
2L5H Solution Structure of the H189Q mutant of the Enzyme I dimer Using Residual Dipolar…

Browse structure collections

About this viewer

MolViewer shows 2EZB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.