2F2P: Calmodulin

Structure of calmodulin bound to a calcineurin peptide: a new way of making an old binding mode. Determined by X-ray diffraction at 2.6 Å resolution. Released 21 Feb 2006.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Bos taurus
Chains: 2
Atoms: 2,699
Mol. weight: 40.17 kDa
Ligands: CA
Released: 21 Feb 2006

Explore 2F2P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2F2P contains 16 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	6-19	14
β-strand	26-27	2	1
α-helix	29-39	11
α-helix	45-53	9
β-strand	63-64	2	1
α-helix	65-92	28
α-helix	102-111	10
α-helix	118-128	11
α-helix	138-144	7
α-helix	158-174	17

Chain B: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	6-19	14
β-strand	27	1	2
α-helix	29-38	10
α-helix	45-53	9
β-strand	63	1	2
α-helix	65-92	28
β-strand	99-100	2	3
α-helix	102-112	11
α-helix	118-128	11
β-strand	136-137	2	3
α-helix	138-146	9
α-helix	157-175	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calmodulin fused with calmodulin-binding domain of calcineurin	A, B	protein	179	Bos taurus	P48452 (AlphaFold model), P62157 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2F2P_1 Calmodulin fused with calmodulin-binding domain of calcineurin (chains A, B)
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE
EVDEMIREADIDGDGQVNYEEFVQMMTAKGGGGGAAARKEVIRNKIRAIGKMARVFSVL

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	8

Primary citation

Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode. Ye, Q., Li, X., Wong, A. et al. Biochemistry (2006) 45:738-745. DOI 10.1021/bi0521801 · PubMed

Other PDB entries of the same protein (UniProt P48452 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2F2O 2.17 Å, Structure of calmodulin bound to a calcineurin peptide: a new way of making an old…
1TCO 2.5 Å, Ternary complex of a calcineurin a fragment, calcineurin B, FKBP12 and the…

Browse structure collections

About this viewer

MolViewer shows 2F2P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.