2FAU: Human vps26

Crystal structure of human vps26. Determined by X-ray diffraction at 2.1 Å resolution. Released 30 May 2006.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,471
Mol. weight: 40.1 kDa
Released: 30 May 2006

Explore 2FAU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FAU contains 5 α-helices and 27 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	12-18	7	1
α-helix	21-23	3
β-strand	26-30	5	2
β-strand	36-40	5	2
β-strand	41-42	2	3
β-strand	48-56	9	1
β-strand	63-65	3	4
β-strand	68-78	11	5
β-strand	85-96	12	5
β-strand	99-101	3	4
β-strand	105-111	7	1
β-strand	121-122	2	5
β-strand	126-136	11	5
α-helix	142	1
β-strand	143-149	7	5
β-strand	150-151	2	3
β-strand	155	1	6
β-strand	164-170	7	7
β-strand	174-180	7	7
β-strand	184-186	3	8
β-strand	190-200	11	7
β-strand	204-217	14	9
α-helix	220-222	3
β-strand	224-234	11	9
β-strand	246-251	6	7
β-strand	261-265	5	9
β-strand	268-280	13	9
β-strand	285-292	8	9
β-strand	293-295	3	8
α-helix	296	1
β-strand	297	1	6
α-helix	298	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vacuolar protein sorting 26	A	protein	341	Homo sapiens	O75436 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2FAU_1 Vacuolar protein sorting 26 (chains A)
MGMSFLGGFFGPICEIDIVLNDGETRKMAEMKTEDGKVEKHYLFYDGESVSGKVNLAFKQ
PGKRLEHQGIRIEFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPY
ESYIGANVRLRYFLKVTIVRRLTDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEF
EYNKSKYHLKDVIVGKIYFLLVRIKIQHMELQLIKKEITGIGPSTTTETETIAKYEIMDG
APVKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVDEEDRRYFKQQEIILWRKA
PEKLRKQRTNFHQRFESPESQASAEQPEMGLVPRGSHHHHH

Primary citation

The retromer subunit Vps26 has an arrestin fold and binds Vps35 through its C-terminal domain. Shi, H., Rojas, R., Bonifacino, J.S. et al. Nat Struct Mol Biol (2006) 13:540-548. DOI 10.1038/nsmb1103 · PubMed

Other PDB entries of the same protein (UniProt O75436 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5F0J 2.7 Å, Structure of retromer VPS26-VPS35 subunits bound to SNX3
5F0P 2.78 Å, Structure of retromer VPS26-VPS35 subunits bound to SNX3 and DMT1(L557M) (SeMet labeled)
5F0M 3.1 Å, Structure of retromer VPS26-VPS35 subunits bound to SNX3 and DMT1 (SeMet labeled)
9Q8M 3.13 Å, VPS35-VPS26-SNX12 Complex
5F0L 3.2 Å, Structure of retromer VPS26-VPS35 subunits bound to SNX3 and DMT1
7BLO 9.5 Å, VPS26 dimer region of metazoan membrane-assembled retromer:SNX3 complex modelled with…

Browse structure collections

About this viewer

MolViewer shows 2FAU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.