2FM9: Salmonella SipA residues 48-264

Structure of Salmonella SipA residues 48-264. Determined by X-ray diffraction at 2.0 Å resolution. Released 21 Mar 2006.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Salmonella typhimurium
Chains: 1
Atoms: 1,633
Mol. weight: 23.58 kDa
Released: 21 Mar 2006

Explore 2FM9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FM9 contains 12 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	51-53	3
α-helix	55-68	14
α-helix	73-82	10
α-helix	86-105	20
α-helix	110-130	21
α-helix	146-165	20
α-helix	168-178	11
α-helix	179-183	5
α-helix	184-195	12
α-helix	198-200	3
α-helix	201-227	27
α-helix	245-258	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cell invasion protein sipA	A	protein	215	Salmonella typhimurium	P0CL52 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2FM9_1 Cell invasion protein sipA (chains A)
PQLEDFPALIKQASLDALFKCGKDAEALKEVFTNSNNVAGKKAIMEFAGLFRSALNATSD
SPEAKTLLMKVGAEYTAQIIKDGLKEKSAFGPWLPETKKAEAKLENLEKQLLDIIKNNTG
GELSKLSTNLVMQEVMPYIASCIEHNFGCTLDPLTRSNLTHLVDKAAAKAVEALDMCHQK
LTQEQGTSVGREARHLEMQTLIPLLLRNVFAQIPA

Primary citation

A common structural motif in the binding of virulence factors to bacterial secretion chaperones. Lilic, M., Vujanac, M., Stebbins, C.E. Mol Cell (2006) 21:653-664. DOI 10.1016/j.molcel.2006.01.026 · PubMed

Other PDB entries of the same protein (UniProt P0CL52 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1Q5Z 1.8 Å, Crystal Structure of the C-terminal Actin Binding Domain of Salmonella Invasion Protein…
2FM8 2.2 Å, Crystal Structure of the Salmonella Secretion Chaperone InvB in Complex with SipA
8C4E 2.6 Å, F-actin decorated by SipA426-685
8C4C 2.7 Å, F-actin decorated by SipA497-669
8UEE 3.2 Å, Atomic structure of Salmonella SipA/F-actin complex by cryo-EM
8VFM 3.6 Å, Salmonella effector protein SipA decorated actin filament

Browse structure collections

About this viewer

MolViewer shows 2FM9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.