2FMM: EMSY-HP1 complex

Crystal Structure of EMSY-HP1 complex. Determined by X-ray diffraction at 1.8 Å resolution. Released 23 May 2006.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 5
Atoms: 3,460
Mol. weight: 48.46 kDa
Released: 23 May 2006

Explore 2FMM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FMM contains 21 α-helices and 21 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	112-115	4
β-strand	119-128	10	5
β-strand	131-138	8	5
β-strand	145-148	4	5
α-helix	149-155	7
α-helix	157-165	9
β-strand	168-170	3	3

Chain B: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	112-115	4
α-helix	117-118	2
β-strand	119-126	8	4
β-strand	133-138	6	4
β-strand	145-148	4	4
α-helix	149-155	7
α-helix	157-165	9
β-strand	168-170	3	3

Chain C: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	112-115	4
α-helix	117-118	2
β-strand	119-126	8	6
β-strand	133-138	6	6
β-strand	145-148	4	6
α-helix	149-155	7
α-helix	157-165	9
β-strand	168-171	4	1

Chain D: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	112-115	4
β-strand	119-126	8	7
β-strand	133-138	6	7
β-strand	145-148	4	7
α-helix	149-155	7
α-helix	157-167	11
β-strand	169-170	2	2

Chain E: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	13-38	26
α-helix	43-55	13
α-helix	60-72	13
α-helix	74-84	11
α-helix	90-95	6
β-strand	98-101	4	1
β-strand	102-103	2	2
α-helix	104-106	3
α-helix	108-110	3
β-strand	112-116	5	3
β-strand	118	1	4
β-strand	123	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein EMSY	E	protein	133	Homo sapiens	Q7Z589 (AlphaFold model)
Chromobox protein homolog 1	A, B, C, D	protein	74	Homo sapiens	P83916 (AlphaFold model)

Sequence of entity 1 (E), FASTA

>2FMM_1 Protein EMSY (chains E)
GPLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSISTERHRAE
VRRAVNDERLTTIAHNMSGPNSSSEWSIEGRRLVPLMPRLVPQTAFTVTANAVANAAIQH
NASLPVPAETGSK

Sequence of entity 2 (A, B, C, D), FASTA

>2FMM_2 Chromobox protein homolog 1 (chains A, B, C, D)
GSKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVI
SFYEERLTWHSYPS

Primary citation

Crystal structure of the HP1-EMSY complex reveals an unusual mode of HP1 binding. Huang, Y., Myers, M.P., Xu, R.M. Structure (2006) 14:703-712. DOI 10.1016/j.str.2006.01.007 · PubMed

Other PDB entries of the same protein (UniProt Q7Z589 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1UZ3 1.1 Å, Crystal structure of novel protein EMSY
1UTU 2.0 Å, Crystal structure of novel protein EMSY truncate

Browse structure collections

About this viewer

MolViewer shows 2FMM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.