The crystal structure of human Ras-related protein, RRAS, in the GDP-bound state. Determined by X-ray diffraction at 1.65 Å resolution. Released 31 Jan 2006.
Explore 2FN4 in 3D Show helices and sheets RCSB PDB PDBe
2FN4 contains 6 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 29-36 | 8 | 1 |
| α-helix | 42-51 | 10 | |
| β-strand | 64-72 | 9 | 1 |
| β-strand | 75-83 | 9 | 1 |
| α-helix | 94-100 | 7 | |
| β-strand | 103-109 | 7 | 1 |
| α-helix | 113-130 | 18 | |
| β-strand | 137-142 | 6 | 1 |
| α-helix | 144-149 | 6 | |
| α-helix | 154-163 | 10 | |
| β-strand | 167-170 | 4 | 1 |
| β-strand | 172 | 1 | 2 |
| β-strand | 177 | 1 | 2 |
| α-helix | 179-193 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ras-related protein R-Ras | A | protein | 181 | Homo sapiens | P10301 (AlphaFold model) |
>2FN4_1 Ras-related protein R-Ras (chains A) SMDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICSVDGIPARLD ILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVGKLFTQILRVKDRDDFPVVLV GNKADLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPP S
The crystal structure of human Ras-related protein, RRAS, in the GDP-bound state. Turnbull, A.P., Elkins, J.M., Gileadi, C. et al. To be published.
Other PDB entries of the same protein (UniProt P10301 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2FN4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.