2FNJ: B30.2/SPRY domain-containing protein GUSTAVUS

Crystal structure of a B30.2/SPRY domain-containing protein GUSTAVUS in complex with Elongin B and Elongin C. Determined by X-ray diffraction at 1.8 Å resolution. Released 21 Mar 2006.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: Drosophila melanogaster, Mus musculus
Chains: 3
Atoms: 3,508
Mol. weight: 49.72 kDa
Released: 21 Mar 2006

Explore 2FNJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FNJ contains 19 α-helices and 33 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	36-38	3
α-helix	39-46	8
α-helix	48-51	4
α-helix	52-57	6
β-strand	60-65	6	1
β-strand	69-72	4	2
β-strand	75-81	7	2
β-strand	87-93	7	1
α-helix	95-96	2
β-strand	97	1	3
β-strand	101-107	7	2
α-helix	110-112	3
β-strand	118-122	5	1
β-strand	129-131	3	1
β-strand	143-147	5	1
β-strand	152-155	4	1
β-strand	163-164	2	1
β-strand	180-186	7	2
β-strand	191-196	6	2
β-strand	199-205	7	2
β-strand	213	1	3
β-strand	214-219	6	1
β-strand	225-234	10	2
α-helix	238-240	3
α-helix	241-249	9

Chain B: 7 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-9	8	4
β-strand	10	1	5
β-strand	12-19	8	4
β-strand	23	1	6
α-helix	24-35	12
α-helix	39-41	3
β-strand	42-46	5	4
β-strand	49-50	2	4
α-helix	51-52	2
β-strand	56	1	6
α-helix	57-60	4
β-strand	68	1	7
β-strand	71	1	7
α-helix	72	1
β-strand	73-79	7	4
β-strand	80	1	8
β-strand	85	1	8
α-helix	86-88	3
β-strand	90	1	5
α-helix	91-93	3

Chain C: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	18-22	5	4
β-strand	28-32	5	4
α-helix	33-36	4
α-helix	40-47	8
β-strand	59-61	3	4
α-helix	67-84	18
α-helix	100-110	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CG2944-PF, isoform F	A	protein	226	Drosophila melanogaster	A1Z6E0 (AlphaFold model)
Transcription elongation factor B polypeptide 2	B	protein	118	Mus musculus	P62869 (AlphaFold model)
Transcription elongation factor B polypeptide 1	C	protein	96	Mus musculus	P83940 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2FNJ_1 CG2944-PF, isoform F (chains A)
MRELQADFVKPARIDILLDMPPASRDLQLKHSWNSEDRSLNIFVKEDDKLTFHRHPVAQS
TDCIRGKVGLTKGLHIWEIYWPTRQRGTHAVVGVCTADAPLHSVGYQSLVGSTEQSWGWD
LGRNKLYHDSKNCAGVTYPAILKNDEAFLVPDKFLVALDMDEGTLSFIVDQQYLGIAFRG
LRGKKLYPIVSAVWGHCEITMRYIGGLDPEPLPLMDLCRRTIRQKI

Sequence of entity 2 (B), FASTA

>2FNJ_2 Transcription elongation factor B polypeptide 2 (chains B)
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPEEQRLYKDDQLLDDGKTLGEC
GFTSQTARPQAPATVGLAFRADDTFEALRIEPFSSPPELPDVMKPQDSGGSANEQAVQ

Sequence of entity 3 (C), FASTA

>2FNJ_3 Transcription elongation factor B polypeptide 1 (chains C)
MYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMY
FTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC

Primary citation

Structural and functional insights into the B30.2/SPRY domain. Woo, J.S., Imm, J.H., Min, C.K. et al. EMBO J (2006) 25:1353-1363. DOI 10.1038/sj.emboj.7600994 · PubMed

Other PDB entries of the same protein (UniProt A1Z6E0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2IHS 2.2 Å, Crystal structure of the B30.2/SPRY domain of GUSTAVUS in complex with a 20-residue VASA…

Browse structure collections

About this viewer

MolViewer shows 2FNJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.