2FPQ: Botulinum Neurotoxin Type D Light Chain

Name: PDB 2FPQ: Crystal Structure of Botulinum Neurotoxin Type D Light Chain
Published: 2006-03-21
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

Crystal Structure of Botulinum Neurotoxin Type D Light Chain. Determined by X-ray diffraction at 1.65 Å resolution. Released 21 Mar 2006.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: Clostridium botulinum
Chains: 1
Atoms: 3,781
Mol. weight: 50.76 kDa
Ligands: ZN
Released: 21 Mar 2006

Explore 2FPQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FPQ contains 20 α-helices and 25 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	13-14	2
β-strand	19-23	5	1
β-strand	34-40	7	1
β-strand	43-46	4	1
α-helix	60-61	2
β-strand	72	1	2
α-helix	80-97	18
α-helix	101-112	12
α-helix	114-116	3
β-strand	126-128	3	3
β-strand	136-142	7	1
β-strand	145-152	8	1
β-strand	156-159	4	1
β-strand	164	1	2
β-strand	169	1	1
α-helix	181-183	3
β-strand	190-193	4	1
β-strand	198-199	2	4
β-strand	201-203	3	5
β-strand	218-220	3	5
α-helix	221-222	2
α-helix	223-238	16
α-helix	242-244	3
β-strand	248-249	2	6
β-strand	265-266	2	6
α-helix	267-273	7
α-helix	275-280	6
α-helix	283-306	24
β-strand	309-311	3	3
α-helix	313-318	6
α-helix	319-329	11
α-helix	332	1
β-strand	333-334	2	7
β-strand	340-341	2	7
α-helix	344-352	9
α-helix	353-357	5
α-helix	360-366	7
β-strand	379	1	5
β-strand	383-384	2	4
β-strand	394	1	8
β-strand	398	1	8
α-helix	403-405	3
α-helix	411-413	3
β-strand	414	1	5
β-strand	422-423	2	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Botulinum neurotoxin D light chain	A	protein	444	Clostridium botulinum	P19321

Sequence of entity 1 (A), FASTA

>2FPQ_1 BOTULINUM NEUROTOXIN D LIGHT CHAIN (chains A)
GPLGSPEFMTWPVKDFNYSDPVNDNDILYLRIPQNKLITTPVKAFMITQNIWVIPERFSS
DTNPSLSKPPRPTSKYQSYYDPSYLSTDEQKDTFLKGIIKLFKRINERDIGKKLINYLVV
GSPFMGDSSTPEDTFDFTRHTTNIAVEKFENGSWKVTNIITPSVLIFGPLPNILDYTASL
TLQGQQSNPSFEGFGTLSILKVAPEFLLTFSDVTSNQSSAVLGKSIFCMDPVIALMHELT
HSLHQLYGINIPSDKRIRPQVSEGFFSQDGPNVQFEELYTFGGLDVEIIPQIERSQLREK
ALGHYKDIAKRLNNINKTIPSSWISNIDKYKKIFSEKYNFDKDNTGNFVVNIDKFNSLYS
DLTNVMSEVVYSSQYNVKNRTHYFSRHYLPVFANILDDNIYTIRDGFNLTNKGFNIENSG
QNIERNPALQKLSSESVVDLFTKV

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Water and common crystallization additives (K) are not listed.

Primary citation

Structure of Botulinum Neurotoxin Type D Light Chain at 1.65 A Resolution: Repercussions for VAMP-2 Substrate Specificity(,). Arndt, J.W., Chai, Q., Christian, T. et al. Biochemistry (2006) 45:3255-3262. DOI 10.1021/bi052518r · PubMed

Other PDB entries of the same protein (UniProt P19321), best resolution first:

3OGG 1.65 Å, Crystal structure of the receptor binding domain of botulinum neurotoxin D
3OBR 1.72 Å, Crystal structure of Botulinum neurotoxin serotype D binding domain
3N7J 2.0 Å, Crystal structure of botulinum neurotoxin serotype D binding domain
3OBT 2.0 Å, Crystal structure of Botulinum neurotoxin serotype D ligand binding domain in complex…
3RMY 2.3 Å, Crystal structure of HCR/D W1238A mutant
5BQN 2.3 Å, Crystal structure of the LHn fragment of botulinum neurotoxin type D, mutant H233Y E230Q
3RMX 2.75 Å, Crystal structure of HCR/D F1240A mutant
5BQM 3.1 Å, Crystal structure of SXN101959, a Clostridium botulinum neurotoxin type D derivative and…

Browse structure collections

About this viewer

MolViewer shows 2FPQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.