2FS1: PSD-1

solution structure of PSD-1. Determined by solution NMR. Released 5 Dec 2006.

Method: Solution NMR
Organisms: Finegoldia magna ATCC 29328, Streptococcus dysgalactiae, Streptococcus equi
Chains: 1
Atoms: 431
Mol. weight: 6.15 kDa
Released: 5 Dec 2006

Explore 2FS1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FS1 contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	5-23	19
α-helix	27-34	8
α-helix	40-51	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PSD-1	A	protein	56	Finegoldia magna ATCC 29328, Streptococcus dysgalactiae, Streptococcus equi, Streptococcus canis, Streptococcus sp.	Q51918 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2FS1_1 PSD-1 (chains A)
MEAVDANSLAQAKEAAIKELKQYGIGDYYIKLINNAKTVEGVESLKNEILKALPTE

Primary citation

Structure, dynamics, and stability variation in bacterial albumin binding modules: implications for species specificity. He, Y., Rozak, D.A., Sari, N. et al. Biochemistry (2006) 45:10102-10109. DOI 10.1021/bi060409m · PubMed

Other PDB entries of the same protein (UniProt Q51918 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5U6A 1.74 Å, Crystal structure of I83E meditope-enabled trastuzumab with azido-PEG3-meditope
5U3D 1.77 Å, Structure of meditope enabled trastuzumab I83E variant
5U5F 1.81 Å, Meditope enabled trastuzumab I83E variant in complex with (ac) CQFDA(PH)2STRRLRCGGSK
6B9Z 1.82 Å, Trastuzumab Fab v3
5U5M 1.88 Å, Crystal structure of I83E meditope-enabled trastuzumab with azido-meditope
6BAH 1.9 Å, Trastuzumab Fab v3 with 5-diphenyl meditope variant
4IOI 1.95 Å, Meditope-enabled trastuzumab in complex with CQFDLSTRRLKC
4HJG 2.0 Å, Meditope-enabled trastuzumab
4HKZ 2.08 Å, Trastuzumab Fab complexed with Protein L and Protein A fragments
6B9Y 2.14 Å, Trastuzumab Fab v3 in complex with 5-phenyl meditope variant
6BAE 2.14 Å, Trastuzumab Fab v3 in complex with CQFDLSTRRLKC
1YMH 2.6 Å, anti-HCV Fab 19D9D6 complexed with protein L (PpL) mutant A66W

Browse structure collections

About this viewer

MolViewer shows 2FS1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.