2FSE: PDB entry 2FSE

Crystallographic structure of a rheumatoid arthritis MHC susceptibility allele, HLA-DR1 (DRB1*0101), complexed with the immunodominant determinant of human type II collagen. Determined by X-ray diffraction at 3.1 Å resolution. Released 19 Sept 2006.

Method: X-ray diffraction
Resolution: 3.1 Å
Organisms: Homo sapiens, Mus musculus
Chains: 6
Atoms: 6,216
Mol. weight: 87.96 kDa
Released: 19 Sept 2006

Explore 2FSE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FSE contains 21 α-helices and 59 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	6-15	10	1
β-strand	19-26	8	1
β-strand	29-35	7	1
β-strand	40-43	4	1
α-helix	46-51	6
α-helix	57-75	19
β-strand	85	1	2
α-helix	86-87	2
β-strand	88-93	6	3
β-strand	103-112	10	3
β-strand	113	1	2
β-strand	118-123	6	4
β-strand	126-127	2	4
α-helix	128	1
β-strand	132-134	3	3
β-strand	138-139	2	3
β-strand	145-153	9	3
β-strand	161-166	6	4
β-strand	174-178	5	4

Chain B: 6 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	7-18	12	1
β-strand	23-31	9	1
β-strand	36-41	6	1
β-strand	46-49	4	1
α-helix	55-63	9
α-helix	65-74	10
α-helix	75-80	6
α-helix	81-86	6
α-helix	87-89	3
β-strand	95	1	5
α-helix	96-97	2
β-strand	98-103	6	6
β-strand	113-122	10	6
β-strand	123	1	5
β-strand	128-133	6	7
β-strand	136-137	2	7
β-strand	140	1	6
β-strand	142-149	8	6
β-strand	155-163	9	6
β-strand	170-176	7	7
β-strand	184-189	6	7

Chain C: 3 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	5-15	11	8
β-strand	19-26	8	8
β-strand	29-35	7	8
β-strand	40-43	4	8
α-helix	46-49	4
α-helix	56-76	21
α-helix	80-84	5
β-strand	85	1	9
β-strand	88-93	6	10
β-strand	103-112	10	10
β-strand	113	1	9
β-strand	118-123	6	11
β-strand	126-127	2	11
β-strand	132-134	3	10
β-strand	138-139	2	10
β-strand	145-153	9	10
β-strand	161-166	6	11
β-strand	174-178	5	11

Chain D: 6 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	7-18	12	8
β-strand	23-31	9	8
β-strand	36-41	6	8
β-strand	47	1	8
α-helix	52-54	3
α-helix	55-63	9
α-helix	65-74	10
α-helix	75-80	6
α-helix	81-86	6
α-helix	87-89	3
β-strand	95	1	12
β-strand	98-102	5	6
β-strand	113-122	10	6
β-strand	123	1	12
β-strand	128-133	6	13
β-strand	136-137	2	13
β-strand	143-149	7	6
β-strand	155-163	9	6
β-strand	171-176	6	13
β-strand	184-188	5	13

Chain E: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1009-1011	3

Chain F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2002-2005	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
H-2 class II histocompatibility antigen, E-K alpha chain	A, C	protein	178	Homo sapiens	P01903 (AlphaFold model)
HLA class II histocompatibility antigen, DRB1-1 beta chain	B, D	protein	187	Mus musculus	P01911 (AlphaFold model)
Collagen alpha-1(II)	E, F	protein	14	Homo sapiens	P02458 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>2FSE_1 H-2 class II histocompatibility antigen, E-K alpha chain (chains A, C)
EHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFASFEAQGALANI
AVDKANLEIMTKRSNYTPITNVAPEVTVLSRSPVNLGEPNILICFIDKFSPPVVNVTWLR
NGRPVTEGVSETVFLPRDDHLFRKFHYLTFLPSTDDFYDCEVDHWGLEEPLRKHWEFE

Sequence of entity 2 (B, D), FASTA

>2FSE_2 HLA class II histocompatibility antigen, DRB1-1 beta chain (chains B, D)
RPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNS
QKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPTVTVYPTKTQPLQHHNLLVCSVSDFY
PGNIEVRWFRNGKEEETGIVSTGLVRNGDWTFQTLVMLETVPQSGEVYTCQVEHPSLTDP
VTVEWKA

Sequence of entity 3 (E, F), FASTA

>2FSE_3 Collagen alpha-1(II) (chains E, F)
AGFKGEQGPKGEPG

Primary citation

Crystallographic Structure of a Rheumatoid Arthritis MHC Susceptibility Allele, HLA-DR1 (DRB1*0101), Complexed with the Immunodominant Determinant of Human Type II Collagen. Rosloniec, E.F., Ivey, R.A., Whittington, K.B. et al. J Immunol (2006) 177:3884-3892. PubMed

Other PDB entries of the same protein (UniProt P01903 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5NI9 1.33 Å, Crystal structure of HLA-DRB1*04:01 with the alpha-enolase peptide 326-340
4X5W 1.34 Å, HLA-DR1 with CLIP102-120(M107W)
5NIG 1.35 Å, Crystal structure of HLA-DRB1*04:01 with modified alpha-enolase peptide 326-340…
8CMC 1.42 Å, Human Leukocyte Antigen class II allotype DR1 presenting SARS-CoV-2 Spike peptide S511-530
8PJF 1.48 Å, Human Leukocyte Antigen class II allotype DR1 presenting P11T->R modified influenza A…
6QZC 1.64 Å, HLA-DR1 with the QAR Peptide
8CMG 1.64 Å, Human Leukocyte Antigen class II allotype DR1 presenting SARS-CoV-2 nsp14 peptide…
8CMH 1.64 Å, Human Leukocyte Antigen class II allotype DR1 presenting SARS-CoV-2 Omicron (BA.1) Spike…
4MD5 1.65 Å, Immune Receptor
4MDJ 1.7 Å, Immune Receptor
8PJE 1.7 Å, Human Leukocyte Antigen class II allotype DR1 presenting influenza A virus…
7YX9 1.76 Å, MHC-II dynamics are maintained in HLA-DR allotypes to ensure catalyzed peptide exchange

Browse structure collections

About this viewer

MolViewer shows 2FSE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.