2FUF: SV40 large T antigen origin-binding domain

Crystal structure of the SV40 large T antigen origin-binding domain. Determined by X-ray diffraction at 1.45 Å resolution. Released 22 Aug 2006.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: Simian virus 40
Chains: 1
Atoms: 1,278
Mol. weight: 15.7 kDa
Ligands: FLC
Released: 22 Aug 2006

Explore 2FUF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FUF contains 6 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	132-135	4
α-helix	140-145	6
β-strand	146	1	1
β-strand	155-163	9	2
α-helix	165-178	14
β-strand	183-189	7	2
β-strand	192-204	13	2
α-helix	205-215	11
β-strand	221-225	5	2
β-strand	226	1	1
α-helix	229-236	8
β-strand	242-246	5	2
α-helix	251-254	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Large T antigen	A	protein	134	Simian virus 40	P03070 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2FUF_1 Large T antigen (chains A)
GSKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRHN
SYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDPFSVIEESL
PGGLKEHDFNPESS

Ligands and cofactors

ID	Name	Formula	Copies
FLC	Citrate anion	C6 H5 O7	1

Primary citation

Crystal structure of the simian virus 40 large T-antigen origin-binding domain. Meinke, G., Bullock, P.A., Bohm, A. J Virol (2006) 80:4304-4312. DOI 10.1128/JVI.80.9.4304-4312.2006 · PubMed

Other PDB entries of the same protein (UniProt P03070 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2IPR 1.5 Å, Origin binding domain of the SV40 large T antigen (residues 131-259). P21 crystal form
3QK2 1.64 Å, Structure-Based Analysis of the Interaction between the Simian Virus 40 T-Antigen Origin…
2ITL 1.65 Å, The origin binding domain of the SV40 large T antigen bound to the functional pen…
3QN2 1.66 Å, Structure-based design of a disulfide-linked oligomeric form of the Simian Virus 40…
5D9I 1.7 Å, SV40 Large T antigen origin binding domain bound to artificial DNA fork
4RXH 1.76 Å, Crystal Structure of Importin-alpha from Neurospora crassa complexed with SV40NLS
1SVM 1.94 Å, Co-crystal structure of SV40 large T antigen helicase domain and ATP
1SVL 1.95 Å, Co-crystal structure of SV40 large T antigen helicase domain and ADP
1Q1S 2.3 Å, Mouse Importin alpha- phosphorylated SV40 CN peptide complex
2NL8 2.3 Å, The origin binding domain of the SV40 large T antigen bound non specifically to a 17 bp…
2NTC 2.4 Å, Crystal Structure of sv40 large T antigen origin binding domain with DNA
1Q1T 2.5 Å, Mouse Importin alpha: non-phosphorylated SV40 CN peptide complex

Browse structure collections

About this viewer

MolViewer shows 2FUF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.