2FV9: TACE

Crystal structure of TACE in complex with JMV 390-1. Determined by X-ray diffraction at 2.02 Å resolution. Released 14 Mar 2006.

Method: X-ray diffraction
Resolution: 2.02 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,147
Mol. weight: 59.24 kDa
Ligands: 002, INN, ZN
Released: 14 Mar 2006

Explore 2FV9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FV9 contains 25 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	224-231	8	1
α-helix	233-238	6
α-helix	244-263	20
β-strand	276-284	9	1
α-helix	314-324	11
α-helix	326-329	4
β-strand	334-339	6	1
α-helix	344-346	3
β-strand	349-351	3	1
β-strand	368-371	4	2
β-strand	376-379	4	2
β-strand	382-386	5	1
β-strand	388-389	2	3
β-strand	392-393	2	3
α-helix	394-395	2
α-helix	396-410	15
α-helix	415-417	3
α-helix	421-423	3
α-helix	427-429	3
α-helix	445-448	4
α-helix	452-469	18
β-strand	471	1	1
α-helix	472-474	3

Chain B: 12 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	224-231	8	4
α-helix	233-238	6
α-helix	244-263	20
β-strand	276-284	9	4
α-helix	288-290	3
α-helix	314-324	11
α-helix	326-329	4
β-strand	334-339	6	4
α-helix	344-346	3
β-strand	349-351	3	4
β-strand	368-371	4	5
β-strand	376-379	4	5
β-strand	382-386	5	4
β-strand	388-389	2	6
β-strand	392-393	2	6
α-helix	394-395	2
α-helix	396-410	15
α-helix	415-417	3
β-strand	421	1	7
β-strand	424	1	7
α-helix	427-429	3
α-helix	445-448	4
α-helix	452-469	18
β-strand	471	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Adam 17	A, B	protein	258	Homo sapiens	P78536 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2FV9_1 ADAM 17 (chains A, B)
PDPMKNTCKLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTAWDNAGFKGYGI
QIEQIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHL
FTYQDFDMGTLGLAYGGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTK
EADLVTTHELGHNFGAEHDPDGLAECAPNEDQGGKYVMYPIAVSGDHENNKMFSQCSKQS
IYKTIESKAQECFQERSN

Ligands and cofactors

ID	Name	Formula	Copies
002	N-[(2R)-2-benzyl-4-(hydroxyamino)-4-oxobutanoyl]-L-isoleucyl-L-leucine	C23 H35 N3 O6	1
INN	N-{(2R)-2-[2-(hydroxyamino)-2-oxoethyl]-4-methylpentanoyl}-3-methyl-L-valyl-N-(…	C19 H37 N5 O5	1
ZN	Zinc ion	Zn	2

Primary citation

Stabilization of the autoproteolysis of TNF-alpha converting enzyme (TACE) results in a novel crystal form suitable for structure-based drug design studies. Ingram, R.N., Orth, P., Strickland, C.L. et al. Protein Eng Des Sel (2006) 19:155-161. DOI 10.1093/protein/gzj014 · PubMed

Other PDB entries of the same protein (UniProt P78536 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2DDF 1.7 Å, Crystal structure of TACE in complex with TAPI-2
8CQY 1.7 Å, Crystal structure of the PTPN3 PDZ domain bound to the PBM TACE C-terminal peptide
3L0V 1.75 Å, Crystal structure of catalytic domain of TACE with the first hydantoin inhibitor…
3EWJ 1.8 Å, Crystal structure of catalytic domain of TACE with carboxylate inhibitor
3KMC 1.8 Å, Crystal structure of catalytic domain of TACE with tartrate-based inhibitor
3KME 1.85 Å, Crystal structure of catalytic domain of TACE with phenyl-pyrrolidinyl-tartrate inhibitor
3LE9 1.85 Å, Crystal structure of the catalytic domain of TACE with Indazolinone-phenyl-hydantoin…
3O64 1.88 Å, Crystal structure of catalytic domain of TACE with 2-(2-Aminothiazol-4-yl)pyrrolidine-Bas…
2I47 1.9 Å, Crystal structure of catalytic domain of TACE with inhibitor
3E8R 1.9 Å, Crystal structure of catalytic domain of TACE with hydroxamate inhibitor
3EDZ 1.9 Å, Crystal structure of catalytic domain of TACE with hydroxamate inhibitor
3LGP 1.9 Å, Crystal structure of catalytic domain of tace with benzimidazolyl-thienyl-tartrate based…

Browse structure collections

About this viewer

MolViewer shows 2FV9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.