Crystal structure of the USP8 interaction domain of human NRDP1. Determined by X-ray diffraction at 1.87 Å resolution. Released 28 Mar 2006.
Explore 2FZP in 3D Show helices and sheets RCSB PDB PDBe
2FZP contains 9 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 193-205 | 13 | |
| β-strand | 207-211 | 5 | 1 |
| α-helix | 214-216 | 3 | |
| β-strand | 217-218 | 2 | 1 |
| α-helix | 223-235 | 13 | |
| α-helix | 240-248 | 9 | |
| α-helix | 252-254 | 3 | |
| α-helix | 262-267 | 6 | |
| α-helix | 271-274 | 4 | |
| β-strand | 277-279 | 3 | 1 |
| α-helix | 280 | 1 | |
| β-strand | 285-289 | 5 | 1 |
| α-helix | 290-292 | 3 | |
| β-strand | 305-310 | 6 | 1 |
| β-strand | 314-316 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| ring finger protein 41 isoform 1 | A | protein | 144 | Homo sapiens | Q9H4P4 (AlphaFold model) |
>2FZP_1 ring finger protein 41 isoform 1 (chains A) MGSSHHHHHHSSGLVPRGSTIEYNEILEWVNSLQPARVTRWGGMISTPDAVLQAVIKRSL VESGCPASIVNELIENAHERSWPQGLATLETRQMNRRYYENYVAKRIPGKQAVVVMACEN QHMGDDMVQEPGLVMIFAHGVEEI
Amino-terminal Dimerization, NRDP1-Rhodanese Interaction, and Inhibited Catalytic Domain Conformation of the Ubiquitin-specific Protease 8 (USP8). Avvakumov, G.V., Walker, J.R., Xue, S. et al. J Biol Chem (2006) 281:38061-38070. DOI 10.1074/jbc.M606704200 · PubMed
Other PDB entries of the same protein (UniProt Q9H4P4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2FZP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.