2G0N: Human RAC3

The Crystal Structure of the Human RAC3 in complex with GDP and Chloride. Determined by X-ray diffraction at 1.9 Å resolution. Released 30 May 2006.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,101
Mol. weight: 40.91 kDa
Ligands: GDP, MG
Released: 30 May 2006

Explore 2G0N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2G0N contains 23 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	1	1
β-strand	2-9	8	1
α-helix	16-25	10
β-strand	39-46	8	1
β-strand	49-56	8	1
α-helix	62-64	3
α-helix	68-71	4
β-strand	77-83	7	1
α-helix	87-92	6
α-helix	93-97	5
α-helix	98-104	7
β-strand	110-115	6	1
α-helix	117-119	3
α-helix	123-130	8
α-helix	136-138	3
α-helix	139-148	10
β-strand	153-156	4	1
α-helix	165-177	13

Chain B: 11 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	2-10	9	2
α-helix	16-25	10
β-strand	39-46	8	2
β-strand	49-56	8	2
α-helix	62-64	3
α-helix	68-71	4
β-strand	77-83	7	2
α-helix	87-92	6
α-helix	93-97	5
α-helix	98-104	7
β-strand	110-115	6	2
α-helix	117-119	3
α-helix	123-131	9
α-helix	136-138	3
α-helix	139-148	10
β-strand	153-156	4	2
α-helix	165-177	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras-related C3 botulinum toxin substrate 3	A, B	protein	179	Homo sapiens	P60763 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2G0N_1 Ras-related C3 botulinum toxin substrate 3 (chains A, B)
SMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTA
GQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDL
RDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLG

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	2
MG	Magnesium ion	Mg	2

Water and common crystallization additives (CL) are not listed.

Primary citation

The Crystal Structure of the Human RAC3 in complex with GDP and Chloride. Ugochukwu, E., Yang, X., Zao, Y. et al. To be published.

Other PDB entries of the same protein (UniProt P60763 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QME 1.75 Å, Crystal structure of human RAC3 in complex with CRIB domain of human p21-activated…
2C2H 1.85 Å, Crystal structure of the human RAC3 in complex with GDP
2IC5 1.9 Å, Crystal structure of human RAC3 grown in the presence of Gpp(NH)p.
2OV2 2.1 Å, The crystal structure of the human RAC3 in complex with the CRIB domain of human…
6TM1 3.71 Å, Crystal structure of the DHR2 domain of DOCK10 in complex with RAC3

Browse structure collections

About this viewer

MolViewer shows 2G0N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.