2G2R: Green-fluorescent antibody 11G10

Green-fluorescent antibody 11G10 in complex with its hapten (nitro-stilbene derivative). Determined by X-ray diffraction at 2.75 Å resolution. Released 5 Dec 2006.

Method: X-ray diffraction
Resolution: 2.75 Å
Organism: Mus musculus
Chains: 4
Atoms: 6,917
Mol. weight: 96.76 kDa
Ligands: TNS
Released: 5 Dec 2006

Explore 2G2R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2G2R contains 36 α-helices and 92 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	12
β-strand	10-13	4	13
β-strand	19-25	7	12
β-strand	27C	1	14
β-strand	31	1	14
β-strand	33-38	6	13
α-helix	43-44	2
β-strand	45-49	5	13
β-strand	53-54	2	13
α-helix	55	1
β-strand	62-67	6	12
β-strand	70-75	6	12
α-helix	80-82	3
β-strand	84-90	7	13
α-helix	96	1
β-strand	97-98	2	13
β-strand	102-106	5	13
β-strand	111	1	15
β-strand	114-118	5	16
α-helix	119-121	3
α-helix	122-127	6
β-strand	129-139	11	16
β-strand	140	1	15
β-strand	145-150	6	17
β-strand	153-155	3	17
β-strand	159-163	5	16
α-helix	164-167	4
β-strand	173-182	10	16
α-helix	183-188	6
β-strand	191-197	7	17
α-helix	203-204	2
β-strand	205-210	6	17

Chain B: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	18
α-helix	7-9	3
β-strand	10-12	3	19
β-strand	18-25	8	18
α-helix	29-31	3
β-strand	32-40	9	19
β-strand	44-52	9	19
β-strand	56-59	4	19
β-strand	64	1	18
β-strand	67-72	6	18
β-strand	77-82	6	18
α-helix	84-86	3
β-strand	88-96	9	19
β-strand	100A-101	2	19
β-strand	107-111	5	19
α-helix	114-116	3
β-strand	117	1	20
α-helix	118-119	2
β-strand	120-124	5	21
α-helix	125-127	3
β-strand	137-147	11	21
β-strand	148	1	20
β-strand	153-157	4	22
α-helix	162-164	3
β-strand	166	1	22
β-strand	171-173	3	21
α-helix	174-176	3
β-strand	177-179	3	21
β-strand	184-194	11	21
β-strand	206-212	6	22
α-helix	213-215	3
β-strand	217-222	6	22

Chain H: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	7
α-helix	7-9	3
β-strand	10-12	3	8
β-strand	18-25	8	7
α-helix	29-31	3
β-strand	33-40	8	8
β-strand	44-52	9	8
β-strand	56-59	4	8
β-strand	64	1	7
β-strand	67-72	6	7
β-strand	77-82	6	7
α-helix	84-86	3
β-strand	88-96	9	8
β-strand	100A-101	2	8
β-strand	107-111	5	8
α-helix	114-116	3
β-strand	117	1	9
α-helix	118-119	2
β-strand	120-124	5	10
α-helix	125-127	3
β-strand	137-147	11	10
β-strand	148	1	9
β-strand	153-157	4	11
α-helix	162-164	3
β-strand	166	1	11
β-strand	171-173	3	10
α-helix	174-176	3
β-strand	177-179	3	10
β-strand	184-194	11	10
β-strand	205-212	7	11
α-helix	213-215	3
β-strand	217-223	7	11

Chain L: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-14	5	2
β-strand	19-25	7	1
β-strand	27C	1	3
β-strand	31	1	3
β-strand	33-38	6	2
α-helix	43-44	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
α-helix	96	1
β-strand	97-98	2	2
β-strand	102-107	6	2
β-strand	111	1	4
β-strand	114-118	5	5
α-helix	119-121	3
α-helix	122-127	6
β-strand	129-139	11	5
β-strand	140	1	4
β-strand	145-150	6	6
β-strand	153-155	3	6
β-strand	159-163	5	5
α-helix	164-167	4
β-strand	173-182	10	5
α-helix	183-188	6
β-strand	191-197	7	6
α-helix	203-204	2
β-strand	205-210	6	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Green-fluorescent antibody (11G10)-light chain	A, L	protein	219	Mus musculus
Green-fluorescent antibody (11G10)-heavy chain	B, H	protein	219	Mus musculus	P84751 (AlphaFold model)

Sequence of entity 1 (A, L), FASTA

>2G2R_1 Green-fluorescent antibody (11G10)-light chain (chains A, L)
DVVMTQTPLTLSVTIGQPASISCRSSQSLLYINGKTHLNWLLQRPGQSPKRLIYLVSKLD
SGVPDRFSGSGSGTDFTLKISRVEAEDLGIYFCLQSTHFPLTFGAGTKLELKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPRDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (B, H), FASTA

>2G2R_2 Green-fluorescent antibody (11G10)-heavy chain (chains B, H)
QVQLQQSGPVLVKPGTSLKMSCKASGYTFTAYYMNWMKQSHGKRLEWIAVINPYNGFTTY
NQKFKGKATLTVDKSSNTAYMDLNSLTSEDSAVYYCVPYDYAADRVYWGHGTLVTVSTAK
TTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSGLY
TLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIEPRG

Ligands and cofactors

ID	Name	Formula	Copies
TNS	N-(trans-4'-nitro-4-stilbenyl)-N-methyl-5-amino-pentanoic acid	C20 H22 N2 O4	2

Water and common crystallization additives (SO4) are not listed.

Primary citation

The Effects of Antibodies on Stilbene Excited-State Energetics. Tian, F., Debler, E.W., Millar, D.P. et al. Angew Chem Int Ed Engl (2006) 45:7763-7765. DOI 10.1002/anie.200602720 · PubMed

Other PDB entries of the same protein (UniProt P84751 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BKJ 1.59 Å, Crystal structure of Fab wo2 bound to the n terminal domain of amyloid beta peptide (1-16)
3BKM 1.6 Å, Structure of anti-amyloid-beta Fab WO2 (Form A, P212121)
1ZAN 1.7 Å, Crystal structure of anti-NGF AD11 Fab
3BKC 1.9 Å, Crystal structure of anti-amyloid beta FAB WO2 (P21, FormB)
2AEP 2.1 Å, An epidemiologically significant epitope of a 1998 influenza virus neuraminidase forms a…
2G5B 2.3 Å, Crystal Structure of the anti-Bax monoclonal antibody 6A7 and a Bax peptide.
4HDI 2.45 Å, Crystal Structure of 3E5 IgG3 FAB from mus musculus
2AEQ 3.0 Å, An epidemiologically significant epitope of a 1998 influenza virus neuraminidase forms a…

Browse structure collections

About this viewer

MolViewer shows 2G2R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.