2G3Q: Ede1 UBA-ubiquitin complex

Solution Structure of Ede1 UBA-ubiquitin complex. Determined by solution NMR. Released 9 May 2006.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 929
Mol. weight: 13.26 kDa
Released: 9 May 2006

Explore 2G3Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2G3Q contains 5 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	1341-1350	10
α-helix	1356-1366	11
α-helix	1370-1378	9

Chain B: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	1
β-strand	12-16	5	1
β-strand	22	1	2
α-helix	23-33	11
β-strand	42-45	4	1
β-strand	48-49	2	1
β-strand	55	1	2
α-helix	57-59	3
β-strand	66-70	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein YBL047C	A	protein	43	Saccharomyces cerevisiae	P34216 (AlphaFold model)
Ubiquitin	B	protein	76	Saccharomyces cerevisiae	P0CG63 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2G3Q_1 Protein YBL047C (chains A)
TTPKSLAVEELSGMGFTEEEAHNALEKCNWDLEAATNFLLDSA

Sequence of entity 2 (B), FASTA

>2G3Q_2 Ubiquitin (chains B)
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGG

Primary citation

Structural Basis for Monoubiquitin Recognition by the Ede1 UBA Domain. Swanson, K.A., Hicke, L., Radhakrishnan, I. J Mol Biol (2006) 358:713-724. DOI 10.1016/j.jmb.2006.02.059 · PubMed

Other PDB entries of the same protein (UniProt P34216 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6WY6 1.77 Å, Crystal structure of S. cerevisiae Atg8 in complex with Ede1 (1220-1247)

Browse structure collections

About this viewer

MolViewer shows 2G3Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.