2G5M: Spinophilin PDZ domain

Spinophilin PDZ domain. Determined by solution NMR. Released 9 Jan 2007.

Method: Solution NMR
Organism: Rattus norvegicus
Chains: 1
Atoms: 849
Mol. weight: 12.14 kDa
Released: 9 Jan 2007

Explore 2G5M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2G5M contains 2 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	1
β-strand	20-25	6	2
β-strand	35-41	7	2
α-helix	47-51	5
β-strand	59	1	2
β-strand	60-63	4	1
β-strand	66-67	2	1
α-helix	73-82	10
β-strand	88-93	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neurabin-2	B	protein	113	Rattus norvegicus	O35274 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>2G5M_1 Neurabin-2 (chains B)
GHMELFPVELEKDSEGLGISIIGMGAGADMGLEKLGIFVKTVTEGGAAHRDGRIQVNDLL
VEVDGTSLVGVTQSFAASVLRNTKGRVRFMIGRERPGEQSEVAQLIQQTLEQE

Primary citation

Structural basis for spinophilin-neurabin receptor interaction. Kelker, M.S., Dancheck, B., Ju, T. et al. Biochemistry (2007) 46:2333-2344. DOI 10.1021/bi602341c · PubMed

Other PDB entries of the same protein (UniProt O35274 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3EGG 1.85 Å, Crystal structure of a complex between Protein Phosphatase 1 alpha (PP1) and the PP1…
3EGH 2.0 Å, Crystal structure of a complex between Protein Phosphatase 1 alpha (PP1), the PP1…

Browse structure collections

About this viewer

MolViewer shows 2G5M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.