2GBQ: GRB2 N-terminal SH3 domain

Solution NMR structure of the GRB2 N-terminal SH3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, J-couplings, and 1H and 13C chemical shifts, 15 structures. Determined by solution NMR. Released 4 Sept 1997.

Method: Solution NMR
Organism: Mus musculus
Chains: 2
Atoms: 552
Mol. weight: 9.65 kDa
Released: 4 Sept 1997

Explore 2GBQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2GBQ contains 2 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
β-strand	9	1	2
β-strand	16	1	1
β-strand	19	1	2
β-strand	24-27	4	1
β-strand	36-41	6	1
β-strand	44-49	6	1
α-helix	50-52	3
β-strand	53-56	4	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-6	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
GRB2	A	protein	74	Mus musculus	Q60631 (AlphaFold model)
SOS-1	B	protein	12	Mus musculus	Q62245 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2GBQ_1 GRB2 (chains A)
GSRRASVGSMEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKN
YIEMKPHPEFIVTD

Sequence of entity 2 (B), FASTA

>2GBQ_2 SOS-1 (chains B)
XVPPPVPPRRRX

Primary citation

Solution structure of the Grb2 N-terminal SH3 domain complexed with a ten-residue peptide derived from SOS: direct refinement against NOEs, J-couplings and 1H and 13C chemical shifts. Wittekind, M., Mapelli, C., Lee, V. et al. J Mol Biol (1997) 267:933-952. DOI 10.1006/jmbi.1996.0886 · PubMed

Other PDB entries of the same protein (UniProt Q60631 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GBQ Solution NMR structure of the GRB2 N-terminal SH3 domain complexed with a ten-residue…
1GBR Orientation of peptide fragments from sos proteins bound to the N-terminal SH3 domain of…
3GBQ Solution NMR structure of the GRB2 N-terminal SH3 domain complexed with a ten-residue…
4GBQ Solution NMR structure of the GRB2 N-terminal SH3 domain complexed with a ten-residue…

Browse structure collections

About this viewer

MolViewer shows 2GBQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.