2GLH: Calcitonin-1

Solution Conformation of Salmon Calcitonin in Sodium Dodecyl Sulfate Micelles. Determined by solution NMR. Released 20 Jun 2006.

Method
Solution NMR
Chains
1
Atoms
239
Mol. weight
3.44 kDa
Released
20 Jun 2006

Explore 2GLH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2GLH contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

ElementResiduesLengthSheet
α-helix4-2118

Molecules and chains

MoleculeChainsTypeLengthOrganismUniProt
Calcitonin-1Aprotein33P01263 (AlphaFold model)
Sequence of entity 1 (A), FASTA
>2GLH_1 Calcitonin-1 (chains A)
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTPX

Primary citation

Structural determinants of salmon calcitonin bioactivity: the role of the Leu-based amphipathic alpha-helix. Andreotti, G., Mendez, B.L., Amodeo, P. et al. J Biol Chem (2006) 281:24193-24203. DOI 10.1074/jbc.M603528200 · PubMed

Other PDB entries of the same protein (UniProt P01263 (AlphaFold model), which also has an AlphaFold model), best resolution first:

Browse structure collections

About this viewer

MolViewer shows 2GLH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.