2GO5: Signal recognition particle receptor

Structure of signal recognition particle receptor (SR) in complex with signal recognition particle (SRP) and ribosome nascent chain complex. Determined by electron microscopy at 7.4 Å resolution. Released 13 Jun 2006.

Method: Electron microscopy
Resolution: 7.4 Å
Organisms: Canis sp., Triticum sp., Homo sapiens
Chains: 9
Atoms: 10,724
Mol. weight: 185.75 kDa
Released: 13 Jun 2006

Explore 2GO5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2GO5 contains 38 α-helices and 31 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain 1: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	4
β-strand	13	1	5
β-strand	14-18	5	4
β-strand	19	1	6
β-strand	23	1	6
α-helix	29-35	7
α-helix	37-39	3
β-strand	54-59	6	4
β-strand	64-69	6	4
α-helix	73-75	3
α-helix	76-93	18
α-helix	95-99	5
α-helix	104-107	4
α-helix	114-124	11

Chain 2: 8 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	64-68	5	7
α-helix	75-84	10
β-strand	90	1	5
β-strand	97-102	6	7
β-strand	110-115	6	7
α-helix	120-130	11
α-helix	131-133	3
β-strand	134-142	9	7
α-helix	146-165	20
β-strand	172-178	7	7
α-helix	185-187	3
α-helix	188-205	18
α-helix	232-234	3
β-strand	239-243	5	7
β-strand	245	1	8
β-strand	257	1	8
α-helix	259-268	10

Chain 4: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	73-76	4	9
α-helix	80-88	9
β-strand	91-96	6	9
α-helix	103-113	11
β-strand	117-123	7	9
β-strand	130-136	7	9
α-helix	143-147	5

Chain 5: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	8-13	6
α-helix	16-37	22
α-helix	46-65	20

Chain 6: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	18-22	5	10
α-helix	25-30	6
α-helix	33-35	3
α-helix	36-50	15
β-strand	58-59	2	10
α-helix	61-67	7
β-strand	79-86	8	10
β-strand	91-95	5	10

Chain B: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	16-18	3	1
α-helix	20-23	4
β-strand	24	1	2
β-strand	41	1	2
α-helix	46-53	8
α-helix	54-56	3
β-strand	59-63	5	1
β-strand	81-85	5	1
β-strand	87	1	3
β-strand	93	1	3
α-helix	102-111	10
α-helix	112-114	3
α-helix	116-119	4

Chain W: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	329-341	13
α-helix	346-349	4
α-helix	366-379	14
α-helix	384-388	5
α-helix	392-398	7
α-helix	401-409	9
α-helix	414-432	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Srp RNA	A	RNA	127	Canis sp.
ribosomal RNA	9	RNA	90	Triticum sp.
Signal recognition particle 19 kDa protein (SRP19)	B	protein	108	Canis sp.	Q5RBR1 (AlphaFold model)
Signal recognition particle 54 kDa protein (SRP54)	W	protein	109	Canis sp.	P61010 (AlphaFold model)
Signal recognition particle receptor alpha subunit (SR a)	1	protein	185	Homo sapiens	P08240 (AlphaFold model)
Signal recognition particle receptor beta subunit (SR b)	2	protein	214	Mus musculus	P47758 (AlphaFold model)
ribosomal protein L35	5	protein	124	Triticum sp.	Q8L805
ribosomal protein L23	4	protein	152	Triticum sp.	O81229
ribosomal protein L31	6	protein	123	Triticum sp.	Q5XLD9

Sequence of entity 1 (A), FASTA

>2GO5_1 SRP RNA (chains A)
GACACUAAGUUCGGCAUCAAUAUGGUGACCUCCCGGGAGCGGGGGACCACCAGGUUGCCU
AAGGAGGGGUGAACCGGCCCAGGUCGGAAACGGAGCAGGUCAAAACUCCCGUGCUGAUCA
GUAGUGU

Sequence of entity 2 (9), FASTA

>2GO5_2 ribosomal RNA (chains 9)
CGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAACGAG
ACGUUAAGCCCACGAGCACUAACAGACCAA

Sequence of entity 3 (B), FASTA

>2GO5_3 Signal recognition particle 19 kDa protein (SRP19) (chains B)
MRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREW
NRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQ

Sequence of entity 4 (W), FASTA

>2GO5_4 Signal recognition particle 54 kDa protein (SRP54) (chains W)
QFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQ
ELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKM

Sequence of entity 5 (1), FASTA

>2GO5_5 Signal recognition particle receptor alpha subunit (SR a) (chains 1)
MSHHHHHHSMVDFFTIFSKGGLVLWCFQGVSDSCTGPVNALIRSVLLQERGGNNSFTHEA
LTLKYKLDNQFELVFVVGFQKILTLTYVDKLIDDVHRLFRDKYRTEIQQQSALSLLNGTF
DFQNDFLRLLREAEESSKIRAPTTMKKFEDSEKAKKPVRSMIETRGEKPKEKAKNSKKKG
AKKEG

Sequence of entity 6 (2), FASTA

>2GO5_6 Signal recognition particle receptor beta subunit (SR b) (chains 2)
MARKSSQRAVLFVGLCDSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVNNNRGNSLTLID
LPGHESLRFQLLDRFKSSARAVVFVVDSAAFQREVKDVAEFLYQVLIDSMALKNSPSLLI
ACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQL
PLKVEFLECSAKGGRGDTGSADIQDLEKWLAKIA

Sequence of entity 7 (5), FASTA

>2GO5_7 ribosomal protein L35 (chains 5)
MSSGKVKAGELWNKSKDDLTKQLAELKTELGQLRIQKVASSGSKLNRIHDIRKSIARVLT
VINAKQRAQLRLFYKNKKYAPLDLRAKQTRAIRRRLSPDEKSRVLEKTKKRTVHFPQRKF
AIKA

Sequence of entity 8 (4), FASTA

>2GO5_8 ribosomal protein L23 (chains 4)
MAPKVAVAKKGDAKAQAAKVAKAVKSGSIKKTAKKIRTSVTFHRPKTLSKARDPKYPRIS
TPGRNKLDQYQILKYPLTTESAMKKIEDNNTLVFIVDLKADKKKIKAAVKKMYDIQAKKV
NTLIRPDGKKKAYVKLTPDYDALDVANKIGII

Sequence of entity 9 (6), FASTA

>2GO5_9 ribosomal protein L31 (chains 6)
MSEKKRAPGPRKDEVVTREYTVNLHKRLHGCTFKKKAPNAIKEIRKFAQKAMGTNDVRID
VKLNKHIWSSGIRSVPRRVRVRIARKRNDEEDAKEELYSLVTVAEVPQEGLKGLGTKVVE
DED

Primary citation

Signal Recognition Particle Receptor Exposes the Ribosomal Translocon Binding Site. Halic, M., Gartmann, M., Schlenker, O. et al. Science (2006) 312:745-747. DOI 10.1126/science.1124864 · PubMed

Browse structure collections

About this viewer

MolViewer shows 2GO5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.