2GV5: Sfi1p/Cdc31p complex

crystal structure of Sfi1p/Cdc31p complex. Determined by X-ray diffraction at 3.0 Å resolution. Released 27 Jun 2006.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Saccharomyces cerevisiae
Chains: 6
Atoms: 6,175
Mol. weight: 94.08 kDa
Released: 27 Jun 2006

Explore 2GV5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2GV5 contains 38 α-helices and 16 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and D: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	19-32	14
β-strand	39-41	3	1
α-helix	42-52	11
α-helix	58-67	10
β-strand	75-77	3	1
α-helix	78-90	13
α-helix	94-105	12
β-strand	112-113	2	2
α-helix	115-124	10
α-helix	131-139	9
β-strand	149-150	2	2
α-helix	151-157	7

Chains B and E: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	19-31	13
β-strand	39-40	2	3
α-helix	42-51	10
α-helix	58-68	11
β-strand	76-77	2	3
α-helix	78-90	13
α-helix	94-105	12
β-strand	112-113	2	4
α-helix	115-125	11
α-helix	131-141	11
β-strand	149-150	2	4
α-helix	151-158	8

Chains C and F: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	643-672	30
α-helix	673-677	5
α-helix	678-706	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cell division control protein 31	A, B, D, E	protein	161	Saccharomyces cerevisiae	P06704 (AlphaFold model)
Sfi1p	C, F	protein	73	Saccharomyces cerevisiae	Q12369 (AlphaFold model)

Sequence of entity 1 (A, B, D, E), FASTA

>2GV5_1 Cell division control protein 31 (chains A, B, D, E)
MSKNRSSLQSGPLNSELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKRE
ILDLIDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRR
VAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTDS

Sequence of entity 2 (C, F), FASTA

>2GV5_2 Sfi1p (chains C, F)
GPLGSKLNDILHVYEKSKERELQSQLFNAWRNRFCFYTEECNIQAISKRNYQLEKMVLKK
FRERLLEIVKSEE

Primary citation

Structural role of Sfi1p-centrin filaments in budding yeast spindle pole body duplication. Li, S., Sandercock, A.M., Conduit, P. et al. J Cell Biol (2006) 173:867-877. DOI 10.1083/jcb.200603153 · PubMed

Other PDB entries of the same protein (UniProt P06704 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FWB 2.5 Å, Sac3:Sus1:Cdc31 complex
4MBE 2.61 Å, Sac3:Sus1:Cdc31:Nup1 complex
3FWC 2.7 Å, Sac3:Sus1:Cdc31 complex
2DOQ 3.0 Å, crystal structure of Sfi1p/Cdc31p complex

Browse structure collections

About this viewer

MolViewer shows 2GV5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.