2GW4: Stony coral fluorescent protein Kaede, red form

Crystal structure of stony coral fluorescent protein Kaede, red form. Determined by X-ray diffraction at 1.6 Å resolution. Released 8 May 2007.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Trachyphyllia geoffroyi
Chains: 4
Atoms: 3,993
Mol. weight: 51.95 kDa
Ligands: NI
Released: 8 May 2007

Explore 2GW4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2GW4 contains 12 α-helices and 26 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	8-18	11	1
β-strand	21-32	12	1
β-strand	37-46	10	1
α-helix	48	1
α-helix	50	1
α-helix	54-56	3
α-helix	58-60	3

Chains B and D: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	70	1	1
β-strand	87-95	9	1
β-strand	100-110	11	1
β-strand	113-123	11	1
β-strand	136-139	4	1
α-helix	140-141	2
β-strand	142-149	8	1
β-strand	152-163	12	1
β-strand	167-179	13	1
α-helix	184-187	4
β-strand	190-201	12	1
β-strand	207-217	11	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kaede	A, C	protein	63	Trachyphyllia geoffroyi	Q8I6J8 (AlphaFold model)
Kaede	B, D	protein	162	Trachyphyllia geoffroyi	Q8I6J8 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>2GW4_1 Kaede (chains A, C)
APMSLIKPEMKIKLLMEGNVNGHQFVIEGDGKGHPFEGKQSMDLVVKEGAPLPFAYDILT
TAF

Sequence of entity 2 (B, D), FASTA

>2GW4_2 Kaede (chains B, D)
XNRVFAKYPDHIPDYFKQSFPKGFSWERSLMFEDGGVCIATNDITLKGDTFFNKVRFDGV
NFPPNGPVMQKKTLKWEASTEKMYLRDGVLTGDITMALLLKGDVHYRCDFRTTYKSRQEG
VKLPGYHFVDHCISILRHDKDYNEVKLYEHAVAHSGLPDNVK

Ligands and cofactors

ID	Name	Formula	Copies
NI	Nickel (II) ion	Ni	4

Primary citation

Crystallographic evidence for water-assisted photo-induced peptide cleavage in the stony coral fluorescent protein Kaede. Hayashi, I., Mizuno, H., Tong, K.I. et al. J Mol Biol (2007) 372:918-926. DOI 10.1016/j.jmb.2007.06.037 · PubMed

Other PDB entries of the same protein (UniProt Q8I6J8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2GW3 1.4 Å, Crystal structure of stony coral fluorescent protein Kaede, green form

Browse structure collections

About this viewer

MolViewer shows 2GW4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.