The Structural basis of Sirtuin Substrate Affinity. Determined by X-ray diffraction at 1.8 Å resolution. Released 5 Dec 2006.
Explore 2H2I in 3D Show helices and sheets RCSB PDB PDBe
2H2I contains 15 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-11 | 9 | |
| β-strand | 16-20 | 5 | 1 |
| α-helix | 22-24 | 3 | |
| α-helix | 26-28 | 3 | |
| α-helix | 38-42 | 5 | |
| β-strand | 49 | 1 | 2 |
| α-helix | 50-55 | 6 | |
| α-helix | 57-67 | 11 | |
| α-helix | 69-73 | 5 | |
| α-helix | 78-88 | 11 | |
| β-strand | 94-97 | 4 | 1 |
| α-helix | 103-106 | 4 | |
| β-strand | 112-114 | 3 | 1 |
| β-strand | 117-124 | 8 | 3 |
| β-strand | 130-132 | 3 | 3 |
| α-helix | 133-139 | 7 | |
| β-strand | 147 | 1 | 4 |
| α-helix | 153 | 1 | |
| β-strand | 154 | 1 | 4 |
| β-strand | 155-159 | 5 | 3 |
| β-strand | 162 | 1 | 2 |
| α-helix | 165-167 | 3 | |
| α-helix | 168-180 | 13 | |
| β-strand | 183-187 | 5 | 1 |
| α-helix | 198-206 | 9 | |
| β-strand | 209-213 | 5 | 1 |
| β-strand | 226-228 | 3 | 1 |
| α-helix | 232-241 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| NAD-dependent deacetylase | A | protein | 246 | Thermotoga maritima | Q9WYW0 (AlphaFold model) |
>2H2I_1 NAD-dependent deacetylase (chains A) MKMKEFLDLLNESRLTVTLTGAGISTPSGIPDFRGPNGIYKKYSQNVFDIDFFYSHPEEF YRFAKEGIFPMLQAKPNLAHVLLAKLEEKGLIEAVITQNIDRLHQRAGSKKVIELHGNVE EYYCVRCEKKYTVEDVIKKLESSDVPLCDDCNSLIRPNIVFFGENLPQDALREAIGLSSR ASLMIVLGSSLVVYPAAELPLITVRSGGKLVIVNLGETPFDDIATLKYNMDVVEFARRVM EEGGIS
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZPG | (2S,5R,8R,11S,14S,17S,21R)-5,8,11,14,17-pentamethyl-4,7,10,13,16,19-hexaoxadoco… | C21 H44 O8 | 1 |
| ZN | Zinc ion | Zn | 1 |
The structural basis of sirtuin substrate affinity. Cosgrove, M.S., Bever, K., Avalos, J.L. et al. Biochemistry (2006) 45:7511-7521. DOI 10.1021/bi0526332 · PubMed
Other PDB entries of the same protein (UniProt Q9WYW0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2H2I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.