2H5Q: MCherry

Crystal structure of mCherry. Determined by X-ray diffraction at 1.36 Å resolution. Released 22 Aug 2006.

Method: X-ray diffraction
Resolution: 1.36 Å
Organism: Discosoma sp.
Chains: 1
Atoms: 2,121
Mol. weight: 26.74 kDa
Released: 22 Aug 2006

Explore 2H5Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2H5Q contains 7 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	12-22	11	1
β-strand	25-36	12	1
β-strand	41-50	10	1
α-helix	52	1
α-helix	54	1
α-helix	58-60	3
α-helix	62-64	3
α-helix	70-72	3
β-strand	74	1	1
α-helix	82-85	4
β-strand	91-99	9	1
β-strand	104-114	11	1
β-strand	117-127	11	1
β-strand	140-143	4	1
α-helix	144-145	2
β-strand	146-153	8	1
β-strand	156-167	12	1
β-strand	172-183	12	1
β-strand	193-204	12	1
β-strand	210-221	12	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
mCherry	A	protein	234	Discosoma sp.	Q5S3G8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2H5Q_1 mCherry (chains A)
MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLP
FAWDILSPQFXSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGE
FIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEV
KTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Primary citation

Novel Chromophores and Buried Charges Control Color in mFruits. Shu, X., Shaner, N.C., Yarbrough, C.A. et al. Biochemistry (2006) 45:9639-9647. DOI 10.1021/bi060773l · PubMed

Other PDB entries of the same protein (UniProt Q5S3G8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2H5P 1.21 Å, Crystal structure of mStrawberry at pH 9.5

Browse more

2H5Q is part of these collections:

Fluorescent and glowing proteins

About this viewer

MolViewer shows 2H5Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.