2H8N: Glutamine-rich domain from histone deacetylase 4

Structure of a glutamine-rich domain from histone deacetylase 4. Determined by X-ray diffraction at 2.6 Å resolution. Released 27 Feb 2007.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,324
Mol. weight: 54.61 kDa
Released: 27 Feb 2007

Explore 2H8N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2H8N contains 9 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	64-112	49
α-helix	115-121	7
α-helix	126-128	3

Chains B, C and D: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	64-123	60
α-helix	126-128	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone deacetylase 4	A, B, C, D	protein	112	Homo sapiens	P56524 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>2H8N_1 Histone deacetylase 4 (chains A, B, C, D)
GSSHHHHHHSSGLVPRGSHMAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLS
RQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQ

Primary citation

Crystal structure of a conserved N-terminal domain of histone deacetylase 4 reveals functional insights into glutamine-rich domains. Guo, L., Han, A., Bates, D.L. et al. Proc Natl Acad Sci U S A (2007) 104:4297-4302. DOI 10.1073/pnas.0608041104 · PubMed

Other PDB entries of the same protein (UniProt P56524 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3V31 1.57 Å, Crystal Structure of the Peptide Bound Complex of the Ankyrin Repeat Domains of Human…
2VQM 1.8 Å, Structure of HDAC4 catalytic domain bound to a hydroxamic acid inhbitor
3UXG 1.85 Å, Crystal structure of RFXANK
5ZOO 1.85 Å, Crystal structure of histone deacetylase 4 (HDAC4) in complex with a SMRT corepressor…
3UZD 1.86 Å, Crystal structure of 14-3-3 GAMMA
2VQQ 1.9 Å, Structure of HDAC4 catalytic domain (a double cysteine-to-alanine mutant) bound to a…
2VQJ 2.1 Å, Structure of HDAC4 catalytic domain bound to a trifluoromethylketone inhbitor
2VQO 2.15 Å, Structure of HDAC4 catalytic domain with a gain-of-function muation bound to a…
6FYZ 2.15 Å, Development and characterization of a CNS-penetrant benzhydryl hydroxamic acid class IIa…
8PDE 2.4 Å, Crystal Structure of the MADS-box/MEF2 Domain of MEF2D bound to dsDNA and HDAC4…
5A2S 2.65 Å, Potent, selective and CNS-penetrant tetrasubstituted cyclopropane class IIa histone…
5ZOP 2.7 Å, Crystal structure of histone deacetylase 4 (HDAC4) in complex with a SMRT corepressor…

Browse structure collections

About this viewer

MolViewer shows 2H8N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.