The X-ray crystal structure of murine OX40L. Determined by X-ray diffraction at 1.45 Å resolution. Released 29 Aug 2006.
Explore 2HEW in 3D Show helices and sheets RCSB PDB PDBe
2HEW contains 4 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 59-61 | 3 | |
| β-strand | 62-71 | 10 | 1 |
| β-strand | 74-78 | 5 | 1 |
| β-strand | 88-90 | 3 | 2 |
| β-strand | 93-95 | 3 | 2 |
| β-strand | 98 | 1 | 3 |
| β-strand | 100-110 | 11 | 1 |
| β-strand | 116-119 | 4 | 1 |
| α-helix | 125-126 | 2 | |
| β-strand | 127-129 | 3 | 1 |
| α-helix | 130-132 | 3 | |
| β-strand | 137-146 | 10 | 1 |
| β-strand | 151-152 | 2 | 2 |
| β-strand | 153-156 | 4 | 1 |
| α-helix | 160-165 | 6 | |
| β-strand | 168-177 | 10 | 1 |
| β-strand | 183 | 1 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tumor necrosis factor ligand superfamily member 4 | F | protein | 152 | Mus musculus | P43488 (AlphaFold model) |
>2HEW_1 Tumor necrosis factor ligand superfamily member 4 (chains F) GSHMSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYL KGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHL QINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
Water and common crystallization additives (SO4) are not listed.
The Crystal Structure of the Costimulatory OX40-OX40L Complex. Compaan, D.M., Hymowitz, S.G. Structure (2006) 14:1321-1330. DOI 10.1016/j.str.2006.06.015 · PubMed
Other PDB entries of the same protein (UniProt P43488 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2HEW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.