2HFT: Extracellular domain of human tissue factor

The crystal structure of the extracellular domain of human tissue factor at 1.7 Å resolution. Determined by X-ray diffraction at 1.69 Å resolution. Released 29 Jan 1996.

Method: X-ray diffraction
Resolution: 1.69 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,936
Mol. weight: 24.79 kDa
Released: 29 Jan 1996

Explore 2HFT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HFT contains 8 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	10-17	8	1
β-strand	20-26	7	1
β-strand	32-40	9	2
β-strand	46-52	7	2
β-strand	56-58	3	1
α-helix	60-63	4
α-helix	64-66	3
β-strand	71-79	9	2
β-strand	94-96	3	2
α-helix	97-99	3
β-strand	100	1	2
α-helix	102-105	4
β-strand	107	1	1
α-helix	108-111	4
β-strand	113-119	7	3
β-strand	122-127	6	3
β-strand	131-136	6	4
β-strand	139-142	4	4
α-helix	143-147	5
α-helix	148-150	3
β-strand	152-158	7	5
β-strand	166-170	5	5
β-strand	174-178	5	3
β-strand	186-192	7	5
β-strand	201	1	5
α-helix	203-207	5
β-strand	208-209	2	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Human tissue factor	A	protein	218	Homo sapiens	P13726 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2HFT_1 HUMAN TISSUE FACTOR (chains A)
SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLT
DEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVG
TKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSQEKGEFRSGKKTAKTNTN
EFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMG

Primary citation

The crystal structure of the extracellular domain of human tissue factor refined to 1.7 A resolution. Muller, Y.A., Ultsch, M.H., de Vos, A.M. J Mol Biol (1996) 256:144-159. DOI 10.1006/jmbi.1996.0073 · PubMed

Other PDB entries of the same protein (UniProt P13726 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6R2W 1.25 Å, Crystal structure of the super-active FVIIa variant VYT in complex with tissue factor
4YLQ 1.4 Å, Crystal Structure of a FVIIa-Trypsin Chimera (FT) in Complex with Soluble Tissue Factor
8QOD 1.57 Å, Crystal structure of fviia in complex with a benzamidine-based inhibitor
2C4F 1.72 Å, crystal structure of factor VII.stf complexed with pd0297121
3TH2 1.72 Å, Mg2+ Is Required for Optimal Folding of the Gamma-Carboxyglutamic Acid (Gla) Domains of…
2A2Q 1.8 Å, Complex of Active-site Inhibited Human Coagulation Factor VIIa with Human Soluble Tissue…
3TH4 1.8 Å, Mg2+ Is Required for Optimal Folding of the Gamma-Carboxyglutamic Acid (Gla) Domains of…
4IBL 1.8 Å, Rubidium Sites in Blood Coagulation Factor VIIa
1JPS 1.85 Å, Crystal structure of tissue factor in complex with humanized Fab D3h44
2AER 1.87 Å, Crystal Structure of Benzamidine-Factor VIIa/Soluble Tissue Factor complex.
8QQ6 1.87 Å, Crystal structure of fviia in complex with a benzamidine-based inhibitor
2FLB 1.95 Å, Discovery of a Novel Hydroxy Pyrazole Based Factor IXa Inhibitor

Browse structure collections

About this viewer

MolViewer shows 2HFT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.