2HLW: Human Ubiquitin-conjugating Enzyme Variant Uev1a

Solution Structure of the Human Ubiquitin-conjugating Enzyme Variant Uev1a. Determined by solution NMR. Released 5 Sept 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,353
Mol. weight: 19.33 kDa
Released: 5 Sept 2006

Explore 2HLW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HLW contains 6 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	36-49	14
α-helix	52-54	3
β-strand	56-60	5	1
β-strand	70	1	2
β-strand	71-75	5	1
α-helix	77-78	2
β-strand	88	1	1
β-strand	90-93	4	2
β-strand	104-107	4	2
β-strand	109	1	3
β-strand	116	1	4
β-strand	122	1	2
β-strand	123	1	4
α-helix	129-132	4
α-helix	140-152	13
α-helix	160-162	3
β-strand	167	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-conjugating enzyme E2 variant 1	A	protein	170	Homo sapiens	Q13404 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2HLW_1 Ubiquitin-conjugating enzyme E2 variant 1 (chains A)
MPGEVQASYLKSQSKLSDEGRLEPRKFHCKGVKVPRNFRLLEELEEGQKGVGDGTVSWGL
EDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSN
GVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN

Primary citation

Structure and interactions of the ubiquitin-conjugating enzyme variant human uev1a: implications for enzymatic synthesis of polyubiquitin chains(,). Hau, D.D., Lewis, M.J., Saltibus, L.F. et al. Biochemistry (2006) 45:9866-9877. DOI 10.1021/bi060631r · PubMed

Other PDB entries of the same protein (UniProt Q13404 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2A4D 1.69 Å, Structure of the human ubiquitin-conjugating enzyme E2 variant 1 (UEV-1)
6D6I 2.55 Å, Ube2V1 in complex with ubiquitin variant Ubv.V1.1 and Ube2N/Ubc13
2C2V 2.9 Å, Crystal structure of the CHIP-UBC13-UEV1a complex

Browse structure collections

About this viewer

MolViewer shows 2HLW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.