2HRV: 2A cysteine proteinase from human rhinovirus 2

2A cysteine proteinase from human rhinovirus 2. Determined by X-ray diffraction at 1.95 Å resolution. Released 3 May 2000.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Human rhinovirus 2
Chains: 2
Atoms: 2,503
Mol. weight: 32.58 kDa
Ligands: ZN
Released: 3 May 2000

Explore 2HRV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HRV contains 9 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	7-16	10	1
α-helix	17-19	3
α-helix	24-26	3
β-strand	29-31	3	1
α-helix	32-34	3
β-strand	36-46	11	1
β-strand	56-61	6	2
α-helix	62-64	3
β-strand	66-71	6	2
β-strand	73-80	8	2
β-strand	89-98	10	2
β-strand	109-112	4	2
β-strand	115-123	9	2
β-strand	127-132	6	2
α-helix	133-136	4

Chain B: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	7-16	10	3
α-helix	17-19	3
β-strand	29-31	3	3
α-helix	32-34	3
β-strand	36-46	11	3
β-strand	56-61	6	4
α-helix	62-64	3
β-strand	66-80	15	4
β-strand	89-98	10	4
β-strand	109-111	3	4
β-strand	116-124	9	4
β-strand	127-132	6	4
α-helix	133-136	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
2A cysteine proteinase	A, B	protein	142	Human rhinovirus 2	P04936 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2HRV_1 2A CYSTEINE PROTEINASE (chains A, B)
GPSDMYVHVGNLIYRNLHLFNSEMHESILVSYSSDLIIYRTNTVGDDYIPSCDCTQATYY
CKHKNRYFPITVTSHDWYEIQESEYYPKHIQYNLLIGEGPCEPGDCGGKLLCKHGVIGIV
TAGGDNHVAFIDLRHFHCAEEQ

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

The structure of the 2A proteinase from a common cold virus: a proteinase responsible for the shut-off of host-cell protein synthesis. Petersen, J.F., Cherney, M.M., Liebig, H.D. et al. EMBO J (1999) 18:5463-5475. DOI 10.1093/emboj/18.20.5463 · PubMed

Other PDB entries of the same protein (UniProt P04936 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5FX6 1.45 Å, Novel inhibitors of human rhinovirus 3C protease
5FX5 1.7 Å, Novel inhibitors of human rhinovirus 3C protease
6FFN 1.75 Å, Structure-based design and synthesis of macrocyclic human rhinovirus 3C protease…
9W3O 1.76 Å, Crystal Structure of Human rhinovirus A2 3C Protease in Complex with a Broad-spectrum…
1CQQ 1.85 Å, Type 2 rhinovirus 3C protease with AG7088 inhibitor
6FFS 1.86 Å, Structure-based design and synthesis of macrocyclic human rhinovirus 3C protease…
1A3R 2.1 Å, FAB fragment (antibody 8F5) complexed with peptide from human rhinovirus (serotype 2)…
7ARA 2.24 Å, Rhinovirus A2 2A protease in complex with zVAM.fmk
2XYA 2.4 Å, Non-covalent inhibtors of rhinovirus 3C protease.
1FPN 2.6 Å, Human rhinovirus serotype 2 (HRV2)
3TN9 3.0 Å, X-ray structure of the HRV2 empty capsid (B-particle)
3VDD 3.2 Å, Structure of HRV2 capsid complexed with antiviral compound BTA798

Browse structure collections

About this viewer

MolViewer shows 2HRV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.