2HWL: Thrombin

Crystal structure of thrombin in complex with fibrinogen gamma' peptide. Determined by X-ray diffraction at 2.4 Å resolution. Released 19 Sept 2006.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 5
Atoms: 4,807
Mol. weight: 69.65 kDa
Ligands: NAG
Released: 19 Sept 2006

Explore 2HWL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HWL contains 28 α-helices and 48 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	8-10	3
α-helix	14C-14G	5

Chain B: 11 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	20-21	2	2
α-helix	22-23	2
β-strand	30-35	6	3
β-strand	39-46	8	3
β-strand	51-54	4	3
α-helix	56-58	3
β-strand	60-60A	2	4
α-helix	60B-60D	3
β-strand	60F-60G	2	4
α-helix	61-63	3
β-strand	64-68	5	3
β-strand	72	1	5
β-strand	81-83	3	3
β-strand	85-90	6	3
β-strand	95	1	6
β-strand	100	1	6
β-strand	104-108	5	3
α-helix	111-114	4
α-helix	120-121	2
β-strand	122	1	2
α-helix	123-125	3
α-helix	126-129C	7
β-strand	135-140	6	2
β-strand	154	1	5
β-strand	156-161	6	2
β-strand	162	1	7
α-helix	165-171	7
β-strand	180-183	4	7
α-helix	184A-185	2
β-strand	189	1	1
β-strand	198-202	5	2
β-strand	207-212	6	2
β-strand	213-215	3	7
β-strand	226-229	4	7
α-helix	235-244	10

Chain D: 12 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	8
β-strand	20-21	2	9
α-helix	22-23	2
β-strand	30-35	6	10
β-strand	39-46	8	10
β-strand	51-54	4	10
α-helix	56-58	3
β-strand	60-60A	2	11
α-helix	60B-60D	3
β-strand	60F-60G	2	11
α-helix	61-63	3
β-strand	64-68	5	10
β-strand	72	1	12
β-strand	81-83	3	10
β-strand	85-90	6	10
β-strand	104-108	5	10
α-helix	111-114	4
α-helix	120-121	2
β-strand	122	1	9
α-helix	123-125	3
α-helix	126-129C	7
β-strand	135-140	6	9
β-strand	154	1	12
β-strand	156-161	6	9
β-strand	162	1	13
α-helix	163-164	2
α-helix	165-170	6
β-strand	180-183	4	13
α-helix	184A-185	2
β-strand	189	1	8
β-strand	198-202	5	9
β-strand	207-212	6	9
β-strand	213-215	3	13
β-strand	226-229	4	13
α-helix	235-244	10

Chain P: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	418-420	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Prothrombin	A, C	protein	36	Homo sapiens	P00734 (AlphaFold model)
Prothrombin	B, D	protein	259	Homo sapiens	P00734 (AlphaFold model)
Fibrinogen gamma' peptide	P	protein	14		P02679 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>2HWL_1 Prothrombin (chains A, C)
TFGSGEADCGLRPLFEKKSLEDKTERELLESYIDGR

Sequence of entity 2 (B, D), FASTA

>2HWL_2 Prothrombin (chains B, D)
IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLL
VRIGKHSRTRYEANIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCL
PDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDSTRIR
ITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFY
THVFRLKKWIQKVIDQFGE

Sequence of entity 3 (P), FASTA

>2HWL_3 Fibrinogen gamma' peptide (chains P)
PAETEYDSLYPEDD

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Water and common crystallization additives (NA) are not listed.

Primary citation

Crystal structure of thrombin in complex with fibrinogen gamma' peptide. Pineda, A.O., Chen, Z.W., Marino, F. et al. Biophys Chem (2007) 125:556-559. DOI 10.1016/j.bpc.2006.08.005 · PubMed

Other PDB entries of the same protein (UniProt P00734 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5AFY 1.12 Å, Thrombin in complex with 3-chloro-benzamide
4UD9 1.12 Å, Thrombin in complex with 5-chlorothiophene-2-carboxamide
4UE7 1.13 Å, Thrombin in complex with 1-amidinopiperidine
4UDW 1.16 Å, Thrombin in complex with 1-(2R)-2-amino-3-phenyl-propanoyl-N-(2,…
4UEH 1.16 Å, Thrombin in complex with benzamidine
5AF9 1.18 Å, Thrombin in complex with 4-Methoxy-N-(2-pyridinyl)benzamide
3RM2 1.23 Å, Human Thrombin in complex with MI003
5AHG 1.24 Å, Thrombin in complex with ((4-chlorophenyl)sulfamoyl))diemethylamine
2BVR 1.25 Å, Human thrombin complexed with fragment-based small molecules occupying the S1 pocket
3VXE 1.25 Å, Human alpha-thrombin-Bivalirudin complex at PD5.0
2UUF 1.26 Å, Thrombin-hirugen binary complex at 1.26A resolution
3SI4 1.27 Å, Human Thrombin In Complex With UBTHR104

Browse structure collections

About this viewer

MolViewer shows 2HWL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.