2I0Y: CFMS tyrosine kinase

cFMS tyrosine kinase (FGF KID) in complex with an arylamide inhibitor. Determined by X-ray diffraction at 1.9 Å resolution. Released 28 Nov 2006.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,412
Mol. weight: 38.4 kDa
Ligands: 5CN
Released: 28 Nov 2006

Explore 2I0Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2I0Y contains 18 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	551-552	2	1
β-strand	576	1	2
α-helix	579-581	3
β-strand	582-590	9	2
β-strand	594-601	8	2
β-strand	604	1	3
β-strand	609	1	3
β-strand	612-618	7	2
α-helix	624-640	17
β-strand	646	1	4
β-strand	649-653	5	2
β-strand	660-664	5	2
β-strand	669-670	2	4
α-helix	671-676	6
α-helix	699-771	20
β-strand	774-775	2	1
α-helix	781-783	3
β-strand	784-786	3	4
α-helix	788-790	3
β-strand	792-794	3	4
α-helix	798-800	3
β-strand	810-811	2	5
β-strand	816-817	2	5
α-helix	819-821	3
α-helix	824	1
α-helix	825-829	5
α-helix	834-849	16
α-helix	853-854	2
α-helix	863-871	9
α-helix	875-878	4
α-helix	883-892	10
α-helix	897-899	3
α-helix	901-902	2
α-helix	903-911	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cFMS Tyrosine Kinase	A	protein	335	Homo sapiens	P07333 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2I0Y_1 cFMS Tyrosine Kinase (chains A)
GVDYKYKQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFG
KVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACT
HGGPVLVITEYCCYGDLLNFLRRKRPPGLEYSYNPSHNPEEQLSSRDLLHFSSQVAQGMA
FLASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESI
FDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYS
IMQACWALEPTHRPTFQQICSFLQEQAQEDRRERD

Ligands and cofactors

ID	Name	Formula	Copies
5CN	5-cyano-furan-2-carboxylic acid [5-hydroxymethyl-2-(4-methyl-piperidin-1-yl)-PH…	C19 H21 N3 O3	1

Primary citation

Crystal structure of the tyrosine kinase domain of colony-stimulating factor-1 receptor (cFMS) in complex with two inhibitors. Schubert, C., Schalk-Hihi, C., Struble, G.T. et al. J Biol Chem (2007) 282:4094-4101. DOI 10.1074/jbc.M608183200 · PubMed

Other PDB entries of the same protein (UniProt P07333 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8JOT 1.69 Å, Crystal structure of CSF-1R kinase domain with sulfatinib
6T2W 1.7 Å, Crystal structure of the CSF1R kinase domain with a dihydropurinone inhibitor (compound 4)
2I1M 1.8 Å, cFMS tyrosine kinase (tie2 KID) in complex with an arylamide inhibitor
6IG8 1.8 Å, Crystal structure of CSF-1R kinase domain with a small molecular inhibitor, JTE-952
8CGC 1.93 Å, Structure of CSF1R in complex with a pyrollopyrimidine (compound 23)
3DPK 1.95 Å, cFMS tyrosine kinase in complex with a pyridopyrimidinone inhibitor
3BEA 2.02 Å, cFMS tyrosine kinase (tie2 KID) in complex with a pyrimidinopyridone inhibitor
3KRJ 2.1 Å, cFMS tyrosine kinase in complex with 4-Cyano-1H-imidazole-2-carboxylic acid…
6N33 2.25 Å, Crystal structure of fms kinase domain with a small molecular inhibitor, PLX5622
8W1L 2.26 Å, Structure of CSF1R kinase domain in complex with Cpd 32
3KRL 2.4 Å, cFMS Tyrosine kinase in complex with 5-Cyano-furan-2-carboxylic acid…
3LCD 2.5 Å, Inhibitor Bound to A DFG-In structure of the Kinase Domain of CSF-1R

Browse structure collections

About this viewer

MolViewer shows 2I0Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.