Solution Structure of Ubp-M Znf-UBP domain. Determined by solution NMR. Released 7 Aug 2007.
Explore 2I50 in 3D Show helices and sheets RCSB PDB PDBe
2I50 contains 5 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-13 | 4 | |
| α-helix | 16-23 | 8 | |
| α-helix | 32-35 | 4 | |
| β-strand | 54-57 | 4 | 1 |
| β-strand | 63-65 | 3 | 1 |
| α-helix | 73-79 | 7 | |
| β-strand | 88-91 | 4 | 1 |
| β-strand | 97-99 | 3 | 1 |
| β-strand | 104-106 | 3 | 1 |
| α-helix | 113-125 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ubiquitin carboxyl-terminal hydrolase 16 | A | protein | 126 | Homo sapiens | Q9Y5T5 (AlphaFold model) |
>2I50_1 Ubiquitin carboxyl-terminal hydrolase 16 (chains A) GSHMPVCRHIRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDKAEEETEEKPSVWLCLKC GHQGCGRNSQEQHALKHYLTPRSEPHCLVLSLDNWSVWCYVCDNEVQYCSSNQLGQVVDY VRKQAS
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 3 |
Solution structure of the Ubp-M BUZ domain, a highly specific protein module that recognizes the C-terminal tail of free ubiquitin. Pai, M.T., Tzeng, S.R., Kovacs, J.J. et al. J Mol Biol (2007) 370:290-302. DOI 10.1016/j.jmb.2007.04.015 · PubMed
Other PDB entries of the same protein (UniProt Q9Y5T5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2I50 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.