Dir primaerstruktur des kristallisierbaren monoklonalen immunoglobulins IgG1 kol. II. Aminosaeuresequenz der L-kette, lambda-typ, subgruppe I (GERMAN). Determined by X-ray diffraction at 3.0 Å resolution. Released 12 Jul 1989.
Explore 2IG2 in 3D Show helices and sheets RCSB PDB PDBe
2IG2 contains 15 α-helices and 51 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 8 |
| β-strand | 11-12 | 2 | 9 |
| β-strand | 18-25 | 8 | 8 |
| α-helix | 29-31 | 3 | |
| β-strand | 34-39 | 6 | 10 |
| β-strand | 46-51 | 6 | 10 |
| β-strand | 58-60 | 3 | 10 |
| β-strand | 68-73 | 6 | 8 |
| β-strand | 78-83 | 6 | 8 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-98 | 7 | 10 |
| β-strand | 99 | 1 | 11 |
| β-strand | 102 | 1 | 12 |
| β-strand | 104A | 1 | 12 |
| β-strand | 105 | 1 | 11 |
| β-strand | 112-114 | 3 | 10 |
| β-strand | 115-116 | 2 | 9 |
| β-strand | 122 | 1 | 13 |
| β-strand | 125-129 | 5 | 14 |
| α-helix | 130-132 | 3 | |
| β-strand | 141-150 | 10 | 14 |
| β-strand | 151 | 1 | 13 |
| β-strand | 156-159 | 4 | 15 |
| β-strand | 164 | 1 | 15 |
| β-strand | 170 | 1 | 14 |
| α-helix | 171-173 | 3 | |
| β-strand | 174-175 | 2 | 14 |
| β-strand | 181-189 | 9 | 14 |
| α-helix | 191-193 | 3 | |
| β-strand | 200-205 | 6 | 15 |
| α-helix | 206-208 | 3 | |
| β-strand | 210-215 | 6 | 15 |
| α-helix | 223-226 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5 | 1 | 1 |
| β-strand | 9-10 | 2 | 2 |
| β-strand | 17-23 | 7 | 1 |
| β-strand | 33-37 | 5 | 2 |
| β-strand | 45-47 | 3 | 2 |
| β-strand | 48 | 1 | 3 |
| β-strand | 52 | 1 | 3 |
| α-helix | 53-54 | 2 | |
| β-strand | 55 | 1 | 4 |
| β-strand | 57 | 1 | 4 |
| β-strand | 61-65 | 5 | 1 |
| β-strand | 69-75 | 7 | 1 |
| α-helix | 79-81 | 3 | |
| β-strand | 84-91 | 8 | 2 |
| β-strand | 96-99 | 4 | 2 |
| α-helix | 100 | 1 | |
| β-strand | 103-105 | 3 | 2 |
| β-strand | 113 | 1 | 5 |
| α-helix | 114-115 | 2 | |
| β-strand | 118-120 | 3 | 6 |
| α-helix | 121-123 | 3 | |
| α-helix | 124-128 | 5 | |
| β-strand | 132-141 | 10 | 6 |
| β-strand | 142 | 1 | 5 |
| β-strand | 147-152 | 6 | 7 |
| β-strand | 155-157 | 3 | 7 |
| β-strand | 161-163 | 3 | 6 |
| α-helix | 164-166 | 3 | |
| β-strand | 174-182 | 9 | 6 |
| α-helix | 184-189 | 6 | |
| β-strand | 193-199 | 7 | 7 |
| β-strand | 202-204 | 3 | 7 |
| β-strand | 207-208 | 2 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| IgG1-lambda kol FAB (light chain) | L | protein | 216 | Homo sapiens | P0CG04 (AlphaFold model) |
| IgG1-lambda kol FAB (heavy chain) | H | protein | 455 | Homo sapiens | P01772 (AlphaFold model) |
>2IG2_1 IGG1-LAMBDA KOL FAB (LIGHT CHAIN) (chains L) QSVLTQPPSASGTPGQRVTISCSGTSSNIGSSTVNWYQQLPGMAPKLLIYRDAMRPSGVP DRFSGSKSGASASLAIGGLQSEDETDYYCAAWDVSLNAYVFGTGTKVTVLGQPKANPTVT LFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASS YLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
>2IG2_2 IGG1-LAMBDA KOL FAB (HEAVY CHAIN) (chains H) EVQLVQSGGGVVQPGRSLRLSCSSSGFIFSSYAMYWVRQAPGKGLEWVAIIWDDGSDQHY ADSVKGRFTISRNDSKNTLFLQMDSLRPEDTGVYFCARDGGHGFCSSASCFGPDYWGQGT PVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFP AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPA PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPQVKFNWYVDGVQVHNAKTKP REQQYNSTYRVVSVLTVLHQNWLDGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
The primary structure of crystallizable monoclonal immunoglobulin IgG1 Kol. II. Amino acid sequence of the L-chain, gamma-type, subgroup I. Kratzin, H.D., Palm, W., Stangel, M. et al. Biol Chem Hoppe Seyler (1989) 370:263-272. PubMed
Other PDB entries of the same protein (UniProt P0CG04 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2IG2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.