2IHD: Human Regulator of G-protein signaling 8, RGS8

Crystal structure of Human Regulator of G-protein signaling 8, RGS8. Determined by X-ray diffraction at 1.7 Å resolution. Released 21 Nov 2006.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,234
Mol. weight: 18.27 kDa
Released: 21 Nov 2006

Explore 2IHD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2IHD contains 11 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	47-52	6
α-helix	57-61	5
α-helix	64-76	13
α-helix	81-92	12
α-helix	98-108	11
α-helix	109-113	5
α-helix	125-134	10
α-helix	144-153	10
α-helix	154-158	5
α-helix	159-163	5
α-helix	166-169	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Regulator of G-protein signaling 8	A	protein	155	Homo sapiens	P57771 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2IHD_1 Regulator of G-protein signaling 8 (chains A)
MHHHHHHSSGVDLGTENLYFQSMLKRLSTEEATRWADSFDVLLSHKYGVAAFRAFLKTEF
SEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPREVNIDFQTREATRKNLQEP
SLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLS

Primary citation

Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits. Soundararajan, M., Willard, F.S., Kimple, A.J. et al. Proc Natl Acad Sci U S A (2008) 105:6457-6462. DOI 10.1073/pnas.0801508105 · PubMed

Other PDB entries of the same protein (UniProt P57771 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ODE 1.9 Å, Crystal structure of the heterodimeric complex of human RGS8 and activated Gi alpha 3
5DO9 2.6 Å, Structure of regulator of G protein signaling 8 (RGS8) in complex with AlF4-activated…

Browse structure collections

About this viewer

MolViewer shows 2IHD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.