2IHR: RF2 of Thermus thermophilus

RF2 of Thermus thermophilus. Determined by X-ray diffraction at 2.5 Å resolution. Released 20 Feb 2007.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Thermus thermophilus
Chains: 1
Atoms: 2,823
Mol. weight: 41.36 kDa
Released: 20 Feb 2007

Explore 2IHR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2IHR contains 19 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain 1: 19 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
α-helix	14-21	8
α-helix	31-33	3
α-helix	37-39	3
α-helix	45-49	5
α-helix	51-63	13
α-helix	67-70	4
α-helix	79-81	3
α-helix	83-85	3
α-helix	87-101	15
β-strand	110-117	8	1
α-helix	122-140	19
β-strand	145-153	9	1
β-strand	159-167	9	1
α-helix	171-175	5
α-helix	176-178	3
β-strand	180-187	8	1
β-strand	196-208	13	1
α-helix	219-221	3
β-strand	222-227	6	2
α-helix	237-239	3
β-strand	243-248	6	2
β-strand	253-257	5	2
α-helix	263-289	27
β-strand	307-310	4	1
α-helix	311-313	3
β-strand	315-318	4	1
β-strand	324-325	2	1
α-helix	328-331	4
α-helix	337-348	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peptide chain release factor 2	1	protein	365	Thermus thermophilus	Q5SM01 (AlphaFold model)

Sequence of entity 1 (1), FASTA

>2IHR_1 Peptide chain release factor 2 (chains 1)
MDLERLAQRLEGLGGIFDIPQKETRLKELERRLEDPSLWNDPEAARKVSQEAARLRRTVD
TFRSLESDLQGLLELMEELPAEEREALKPELEEAAKKLDELYHQTLLNFPHAEKNAILTI
QPGAGGTEACDWAEMLLRMYTRFAERQGFQVEVVDLTPGPEAGIDYAQILVKGENAYGLL
SPEAGVHRLVRPSPFDASGRRHTSFAGVEVIPEVDEEVEVVLKPEELRIDVMRASGPGGQ
GVNTTDSAVRVVHLPTGITVTCQTTRSQIKNKELALKILKARLYELERKKREEELKALRG
EVRPIEWGSQIRSYVLDKNYVKDHRTGLMRHDPENVLDGDLMDLIWAGLEWKAGRRQGTE
EVEAE

Primary citation

Release factors 2 from Escherichia coli and Thermus thermophilus: structural, spectroscopic and microcalorimetric studies. Zoldak, G., Redecke, L., Svergun, D.I. et al. Nucleic Acids Res (2007) 35:1343-1353. DOI 10.1093/nar/gkl696 · PubMed

Other PDB entries of the same protein (UniProt Q5SM01 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4V67 3.0 Å, Crystal structure of a translation termination complex formed with release factor RF2.
4V5J 3.1 Å, Structure of the 70S ribosome bound to Release factor 2 and a substrate analog provides…
6C5L 3.2 Å, Conformation of methylated GGQ in the Peptidyl Transferase Center during translation…
5MDY 3.35 Å, Structure of ArfA and TtRF2 bound to the 70S ribosome (pre-accommodated state)
4V5E 3.45 Å, Insights into translational termination from the structure of RF2 bound to the ribosome
4V4S 6.76 Å, Crystal structure of the whole ribosomal complex.

Browse structure collections

About this viewer

MolViewer shows 2IHR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.