2IIF: Integration host factor

single chain Integration Host Factor mutant protein (scIHF2-K45aE) in complex with DNA. Determined by X-ray diffraction at 2.72 Å resolution. Released 20 Feb 2007.

Method: X-ray diffraction
Resolution: 2.72 Å
Organisms: synthetic construct, Escherichia coli
Chains: 4
Atoms: 3,207
Mol. weight: 44.81 kDa
Ligands: MN
Released: 20 Feb 2007

Explore 2IIF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2IIF contains 9 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	1
α-helix	5-13	9
α-helix	21-40	20
β-strand	47	1	2
α-helix	49-60	12
α-helix	64-83	20
α-helix	86	1
β-strand	87-90	4	1
β-strand	94-101	8	1
α-helix	102-103	2
β-strand	104	1	3
β-strand	117	1	3
β-strand	120-127	8	1
α-helix	129-138	10
β-strand	144-146	3	2
β-strand	150-157	8	2
β-strand	160-163	4	4
β-strand	170-173	4	4
α-helix	174-175	2
β-strand	176-183	8	2
α-helix	185-191	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phage P H' site	C	DNA	35	synthetic construct
DNA (5'-d(dgpdgpdcpdcpdapdapdapdapdapdapdgpdcpdapdtp*dt)-3')	D	DNA	15	synthetic construct
DNA (5'-d(dgpdcpdtpdtpdapdtpdcpdapdapdtpdtpdtpdgpdtpdtpdgpdcpdapdcpdc)-3')	E	DNA	20	synthetic construct
Integration host factor	A	protein	204	Escherichia coli	P0A6X7 (AlphaFold model), P0A6Y1 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>2IIF_1 Phage P H' site (chains C)
CGGTGCAACAAATTGATAAGCAATGCTTTTTTGGC

Sequence of entity 2 (D), FASTA

>2IIF_2 DNA (5'-D(*DGP*DGP*DCP*DCP*DAP*DAP*DAP*DAP*DAP*DAP*DGP*DCP*DAP*DTP*DT)-3') (chains D)
GGCCAAAAAAGCATT

Sequence of entity 3 (E), FASTA

>2IIF_3 DNA (5'-D(*DGP*DCP*DTP*DTP*DAP*DTP*DCP*DAP*DAP*DTP*DTP*DTP*DGP*DTP*DTP*DGP*DCP*DAP*DCP*DC)-3') (chains E)
GCTTATCAATTTGTTGCACC

Sequence of entity 4 (A), FASTA

>2IIF_4 Integration host factor (chains A)
MASTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGGSGGLTKAEMSEYLFDKL
GLSKRDAKELVELFFEEIRRALENGEQVELSGFGNFDLRDKNQRPGRNPKTGEDIPITAR
RVVTFRPGQKLKSRVENAGGGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPH
FKPGKELRDRANIYGGSGHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
MN	Manganese (II) ion	Mn	8

Primary citation

A Divalent Metal-mediated Switch Controlling Protein-induced DNA Bending. Bao, Q., Chen, H., Liu, Y. et al. J Mol Biol (2007) 367:731-740. DOI 10.1016/j.jmb.2006.09.082 · PubMed

Other PDB entries of the same protein (UniProt P0A6X7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1OWF 1.95 Å, Crystal structure of a mutant IHF (BetaE44A) complexed with the native H' Site
2HT0 2.0 Å, IHF bound to doubly nicked DNA
1OWG 2.1 Å, Crystal structure of WT IHF complexed with an altered H' site (T44A)
1OUZ 2.41 Å, Crystal structure of a mutant IHF (BetaE44A) complexed with a variant H' Site (T44A)
2IIE 2.41 Å, single chain Integration Host Factor protein (scIHF2) in complex with DNA
1IHF 2.5 Å, Integration host factor/dna complex
9F10 2.94 Å, CryoEM structure of the F plasmid relaxosome with TraI in its TE mode, without accessory…
9F0Z 3.42 Å, CryoEM structure of the F plasmid relaxosome with truncated TraI1-863 in its TE mode,…
9F12 3.42 Å, CryoEM structure of the F plasmid relaxosome with oriT DNA ss-27_-3ds-2_+143 and TraI…
9F0Y 3.45 Å, CryoEM structure of the F plasmid relaxosome with TraI in its TE mode, derived from the…
5WFE 3.64 Å, Cas1-Cas2-IHF-DNA holo-complex
9F11 3.68 Å, CryoEM structure of the F plasmid relaxosome with oriT DNA ss-27_+3ds+4_+143 and TraI…

Browse structure collections

About this viewer

MolViewer shows 2IIF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.