2IIJ: Human Asf1a

Name: PDB 2IIJ: Structure of human Asf1a in complex with histone H3
Published: 2007-02-13
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Structure of human Asf1a in complex with histone H3. Determined by solution NMR. Released 13 Feb 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,396
Mol. weight: 19.93 kDa
Released: 13 Feb 2007

Explore 2IIJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2IIJ contains 5 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	4-11	8	1
β-strand	16-17	2	2
α-helix	21	1
β-strand	22-33	12	1
β-strand	38-44	7	2
α-helix	51-53	3
β-strand	55-62	8	2
β-strand	66-76	11	1
α-helix	86-89	4
β-strand	92-101	10	2
β-strand	104-117	14	2
α-helix	120-124	5
β-strand	135-146	12	2

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	122-132	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ASF1A protein	A	protein	158	Homo sapiens	Q9Y294 (AlphaFold model)
Histone H3	B	protein	18	Homo sapiens	Q71DI3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2IIJ_1 ASF1A protein (chains A)
GAMAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLD
SVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYT
ETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDN

Sequence of entity 2 (B), FASTA

>2IIJ_2 Histone H3 (chains B)
GAMGKDIQLARRIRGERA

Primary citation

Structure of the histone chaperone asf1 bound to the histone h3 C-terminal helix and functional insights. Agez, M., Chen, J., Guerois, R. et al. Structure (2007) 15:191-199. DOI 10.1016/j.str.2007.01.002 · PubMed

Other PDB entries of the same protein (UniProt Q9Y294 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9SVO 1.6 Å, Crystal structure hASF1A 156-cr5
9TRB 1.65 Å, Crystal structure hASF1A 156-cr13
9SQK 1.7 Å, Crystal structure hASF1A 156-cr17
6ZUF 1.8 Å, Urea-based Foldamer Inhibitor chimera C2 in complex with ASF1 Histone chaperone
6F0H 1.98 Å, Crystal structure ASF1-ip4
9SS3 2.0 Å, Crystal structure hASF1A 156-cr7
6F0F 2.0 Å, Crystal structure ASF1-ip2_s
7LNY 2.1 Å, Apo structure of the Histone chaperone ASF1A residues 1-155
8CJ2 2.13 Å, Urea-based foldamer inhibitor c3u_5 chimera in complex with ASF1 histone chaperone
6F0G 2.3 Å, Crystal structure ASF1-ip3
8CJ1 2.56 Å, Urea-based foldamer inhibitor c3u_3 chimera in complex with ASF1 histone chaperone
2I32 2.7 Å, Structure of a human ASF1a-HIRA complex and insights into specificity of histone…

Browse structure collections

About this viewer

MolViewer shows 2IIJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.