Bright-state structure of the reversibly switchable fluorescent protein Dronpa. Determined by X-ray diffraction at 1.8 Å resolution. Released 5 Dec 2006.
Explore 2IOV in 3D Show helices and sheets RCSB PDB PDBe
2IOV contains 26 α-helices and 52 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-18 | 11 | 1 |
| β-strand | 21-32 | 12 | 1 |
| β-strand | 37-46 | 10 | 1 |
| α-helix | 48 | 1 | |
| α-helix | 50 | 1 | |
| α-helix | 55-58 | 4 | |
| β-strand | 70 | 1 | 1 |
| α-helix | 78-81 | 4 | |
| β-strand | 87-95 | 9 | 1 |
| β-strand | 100-110 | 11 | 1 |
| β-strand | 113-123 | 11 | 1 |
| β-strand | 136-139 | 4 | 1 |
| α-helix | 140-141 | 2 | |
| β-strand | 142-149 | 8 | 1 |
| β-strand | 152-163 | 12 | 1 |
| β-strand | 168-179 | 12 | 1 |
| α-helix | 184-187 | 4 | |
| β-strand | 189-200 | 12 | 1 |
| β-strand | 206-216 | 11 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-18 | 11 | 2 |
| β-strand | 21-32 | 12 | 2 |
| β-strand | 37-46 | 10 | 2 |
| α-helix | 48 | 1 | |
| α-helix | 50 | 1 | |
| α-helix | 55-58 | 4 | |
| β-strand | 70 | 1 | 2 |
| α-helix | 78-82 | 5 | |
| β-strand | 87-95 | 9 | 2 |
| β-strand | 100-110 | 11 | 2 |
| β-strand | 113-123 | 11 | 2 |
| β-strand | 136-139 | 4 | 2 |
| α-helix | 140-141 | 2 | |
| β-strand | 142-149 | 8 | 2 |
| β-strand | 152-163 | 12 | 2 |
| β-strand | 168-179 | 12 | 2 |
| α-helix | 184-187 | 4 | |
| β-strand | 189-200 | 12 | 2 |
| β-strand | 206-216 | 11 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 0-2 | 3 | |
| β-strand | 8-18 | 11 | 3 |
| β-strand | 21-32 | 12 | 3 |
| β-strand | 37-46 | 10 | 3 |
| α-helix | 48 | 1 | |
| α-helix | 50 | 1 | |
| α-helix | 55-58 | 4 | |
| β-strand | 70 | 1 | 3 |
| α-helix | 78-81 | 4 | |
| β-strand | 87-95 | 9 | 3 |
| β-strand | 100-110 | 11 | 3 |
| β-strand | 113-123 | 11 | 3 |
| β-strand | 136-139 | 4 | 3 |
| α-helix | 140-141 | 2 | |
| β-strand | 142-149 | 8 | 3 |
| β-strand | 152-163 | 12 | 3 |
| β-strand | 168-179 | 12 | 3 |
| α-helix | 184-187 | 4 | |
| β-strand | 189-200 | 12 | 3 |
| β-strand | 206-216 | 11 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 0-3 | 4 | |
| β-strand | 8-18 | 11 | 4 |
| β-strand | 21-32 | 12 | 4 |
| β-strand | 37-46 | 10 | 4 |
| α-helix | 48 | 1 | |
| α-helix | 50 | 1 | |
| α-helix | 55-58 | 4 | |
| β-strand | 70 | 1 | 4 |
| α-helix | 78-81 | 4 | |
| β-strand | 87-95 | 9 | 4 |
| β-strand | 100-110 | 11 | 4 |
| β-strand | 113-123 | 11 | 4 |
| β-strand | 136-139 | 4 | 4 |
| α-helix | 140-141 | 2 | |
| β-strand | 142-149 | 8 | 4 |
| β-strand | 152-163 | 12 | 4 |
| β-strand | 168-179 | 12 | 4 |
| α-helix | 184-187 | 4 | |
| β-strand | 189-200 | 12 | 4 |
| β-strand | 206-216 | 11 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Fluorescent protein Dronpa | A, B, C, D | protein | 255 | Echinophyllia sp. SC22 | Q5TLG6 (AlphaFold model) |
>2IOV_1 Fluorescent protein Dronpa (chains A, B, C, D) MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPMSVIKPDMKIKLRMEGAVNGHPFAIEG VGLGKPFEGKQSMDLKVKEGGPLPFAYDILTTVFXNRVFAKYPENIVDYFKQSFPEGYSW ERSMNYEDGGICNATNDITLDGDCYIYEIRFDGVNFPANGPVMQKRTVKWEPSTEKLYVR DGVLKGDVNMALSLEGGGHYRCDFKTTYKAKKVVQLPDYHFVDHHIEIKSHDKDYSNVNL HEHAEAHSELPRQAK
1.8 A bright-state structure of the reversibly switchable fluorescent protein Dronpa guides the generation of fast switching variants. Stiel, A.C., Trowitzsch, S., Weber, G. et al. Biochem J (2007) 402:35-42. DOI 10.1042/BJ20061401 · PubMed
Other PDB entries of the same protein (UniProt Q5TLG6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2IOV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.