Origin binding domain of the SV40 large T antigen (residues 131-259). P21 crystal form. Determined by X-ray diffraction at 1.5 Å resolution. Released 12 Dec 2006.
Explore 2IPR in 3D Show helices and sheets RCSB PDB PDBe
2IPR contains 11 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 133-135 | 3 | |
| α-helix | 140-145 | 6 | |
| β-strand | 146 | 1 | 1 |
| β-strand | 155-163 | 9 | 2 |
| α-helix | 165-178 | 14 | |
| β-strand | 183-189 | 7 | 2 |
| β-strand | 192-204 | 13 | 2 |
| α-helix | 205-215 | 11 | |
| β-strand | 216 | 1 | 3 |
| β-strand | 221-225 | 5 | 2 |
| β-strand | 226 | 1 | 1 |
| α-helix | 229-236 | 8 | |
| β-strand | 242-246 | 5 | 2 |
| α-helix | 254-256 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 140-145 | 6 | |
| β-strand | 146 | 1 | 4 |
| β-strand | 156-163 | 8 | 5 |
| α-helix | 165-179 | 15 | |
| β-strand | 183-189 | 7 | 5 |
| β-strand | 192-203 | 12 | 5 |
| α-helix | 205-213 | 9 | |
| β-strand | 216 | 1 | 3 |
| β-strand | 221-225 | 5 | 5 |
| β-strand | 226 | 1 | 4 |
| α-helix | 229-236 | 8 | |
| β-strand | 242-246 | 5 | 5 |
| α-helix | 254-256 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| large T antigen | A, B | protein | 133 | Simian virus 40 | P03070 (AlphaFold model) |
>2IPR_1 large T antigen (chains A, B) GSHMKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISR HNSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDPFSVIEE SLPGGLKEHDFNP
Structure of the origin-binding domain of simian virus 40 large T antigen bound to DNA. Bochkareva, E., Martynowski, D., Seitova, A. et al. EMBO J (2006) 25:5961-5969. DOI 10.1038/sj.emboj.7601452 · PubMed
Other PDB entries of the same protein (UniProt P03070 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2IPR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.