Human mitochondrial beta-ketoacyl ACP synthase complexed with hexanoic acid. Determined by X-ray diffraction at 1.65 Å resolution. Released 6 Feb 2007.
Explore 2IWZ in 3D Show helices and sheets RCSB PDB PDBe
2IWZ contains 47 α-helices and 53 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | -1-41 | 5 | 1 |
| β-strand | 44-53 | 10 | 2 |
| β-strand | 56-57 | 2 | 2 |
| α-helix | 59-67 | 9 | |
| β-strand | 73-75 | 3 | 3 |
| α-helix | 79-81 | 3 | |
| β-strand | 88-90 | 3 | 3 |
| α-helix | 91-93 | 3 | |
| β-strand | 94 | 1 | 4 |
| β-strand | 101 | 1 | 4 |
| α-helix | 103-105 | 3 | |
| α-helix | 109-112 | 4 | |
| α-helix | 117-133 | 17 | |
| α-helix | 140-144 | 5 | |
| β-strand | 146-152 | 7 | 2 |
| α-helix | 157-170 | 14 | |
| α-helix | 172-174 | 3 | |
| α-helix | 179-182 | 4 | |
| α-helix | 187-196 | 10 | |
| β-strand | 202-203 | 2 | 2 |
| β-strand | 205 | 1 | 5 |
| α-helix | 208-210 | 3 | |
| α-helix | 211-225 | 15 | |
| β-strand | 230-237 | 8 | 2 |
| α-helix | 242-250 | 9 | |
| β-strand | 254 | 1 | 6 |
| β-strand | 274 | 1 | 6 |
| β-strand | 276 | 1 | 7 |
| β-strand | 277 | 1 | 3 |
| β-strand | 279-287 | 9 | 2 |
| α-helix | 288-293 | 6 | |
| β-strand | 300-309 | 10 | 2 |
| α-helix | 317-318 | 2 | |
| α-helix | 322-335 | 14 | |
| α-helix | 339-341 | 3 | |
| β-strand | 344-346 | 3 | 2 |
| α-helix | 353-367 | 15 | |
| α-helix | 368-372 | 5 | |
| β-strand | 375-377 | 3 | 2 |
| α-helix | 380-383 | 4 | |
| β-strand | 385 | 1 | 7 |
| α-helix | 387-389 | 3 | |
| α-helix | 390-404 | 15 | |
| β-strand | 406-407 | 2 | 8 |
| β-strand | 410 | 1 | 9 |
| β-strand | 423 | 1 | 2 |
| β-strand | 426 | 1 | 9 |
| β-strand | 430-431 | 2 | 8 |
| β-strand | 439-446 | 8 | 2 |
| β-strand | 450-457 | 8 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | -1-41 | 5 | 1 |
| β-strand | 44-53 | 10 | 10 |
| β-strand | 56-57 | 2 | 10 |
| α-helix | 59-67 | 9 | |
| β-strand | 73-75 | 3 | 11 |
| α-helix | 79-81 | 3 | |
| β-strand | 88-90 | 3 | 11 |
| β-strand | 94 | 1 | 12 |
| β-strand | 101 | 1 | 12 |
| α-helix | 103-105 | 3 | |
| α-helix | 109-114 | 6 | |
| α-helix | 117-133 | 17 | |
| α-helix | 140-144 | 5 | |
| β-strand | 146-152 | 7 | 10 |
| α-helix | 157-170 | 14 | |
| α-helix | 172-174 | 3 | |
| α-helix | 179-183 | 5 | |
| α-helix | 187-196 | 10 | |
| β-strand | 202-203 | 2 | 10 |
| β-strand | 205 | 1 | 5 |
| α-helix | 208-210 | 3 | |
| α-helix | 211-225 | 15 | |
| β-strand | 230-237 | 8 | 10 |
| α-helix | 242-250 | 9 | |
| β-strand | 254 | 1 | 13 |
| β-strand | 274 | 1 | 13 |
| β-strand | 276 | 1 | 14 |
| β-strand | 277 | 1 | 11 |
| β-strand | 279-287 | 9 | 10 |
| α-helix | 288-293 | 6 | |
| β-strand | 300-309 | 10 | 10 |
| α-helix | 317-318 | 2 | |
| α-helix | 322-335 | 14 | |
| α-helix | 339-341 | 3 | |
| β-strand | 344-346 | 3 | 10 |
| α-helix | 353-367 | 15 | |
| α-helix | 368-372 | 5 | |
| β-strand | 375-377 | 3 | 10 |
| α-helix | 380-383 | 4 | |
| β-strand | 385 | 1 | 14 |
| α-helix | 387-389 | 3 | |
| α-helix | 390-404 | 15 | |
| β-strand | 406-407 | 2 | 15 |
| α-helix | 408-409 | 2 | |
| β-strand | 410 | 1 | 16 |
| β-strand | 426 | 1 | 16 |
| β-strand | 430-431 | 2 | 15 |
| α-helix | 437-438 | 2 | |
| β-strand | 439-446 | 8 | 10 |
| β-strand | 450-457 | 8 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 3-oxoacyl-[acyl-carrier-protein] synthase | A, B | protein | 438 | HOMO SAPIENS | Q9NWU1 (AlphaFold model) |
>2IWZ_1 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE (chains A, B) MRGSHHHHHHGSIEGRSRLHRRVVITGIGLVTPLGVGTHLVWDRLIGGESGIVSLVGEEY KSIPCSVAAYVPRGSDEGQFNEQNFVSKSDIKSMSSPTIMAIGAAELAMKDSGWHPQSEA DQVATGVAIGMGMIPLEVVSETALNFQTKGYNKVSPFFVPKILVNMAAGQVSIRYKLKGP NHAVSTACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCISPLSLAGFSRARALSTNSDPK LACRPFHPKRDGFVMGEGAAVLVLEEYEHAVQRRARIYAEVLGYGLSGDAGHITAPDPEG EGALRCMAAALKDAGVQPEEISYINAHATSTPLGDAAENKAIKHLFKDHAYALAVSSTKG ATGHLLGAAGAVEAAFTTLACYYQKLPPTLNLDCSEPEFDLNYVPLKAQEWKTEKRFIGL TNSFGFGGTNATLCIAGL
| ID | Name | Formula | Copies |
|---|---|---|---|
| 6NA | Hexanoic acid | C6 H12 O2 | 2 |
Water and common crystallization additives (NH4) are not listed.
Structure of the Human Beta-Ketoacyl [Acp] Synthase from the Mitochondrial Type II Fatty Acid Synthase. Christensen, C.E., Kragelund, B.B., von Wettstein-Knowles, P. et al. Protein Sci (2007) 16:261-272. DOI 10.1110/PS.062473707 · PubMed
Other PDB entries of the same protein (UniProt Q9NWU1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2IWZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.