2J04: Hypothetical protein YPL007C

Name: PDB 2J04: The tau60-tau91 subcomplex of yeast transcription factor IIIC
Published: 2006-10-23
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

The tau60-tau91 subcomplex of yeast transcription factor IIIC. Determined by X-ray diffraction at 3.2 Å resolution. Released 23 Oct 2006.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: SACCHAROMYCES CEREVISIAE
Chains: 4
Atoms: 16,935
Mol. weight: 253.37 kDa
Released: 23 Oct 2006

Explore 2J04 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2J04 contains 51 α-helices and 158 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 41 β-strands

Element	Residues	Length	Sheet
α-helix	4	1
β-strand	5	1	1
α-helix	6	1
β-strand	7-9	3	2
β-strand	21-23	3	3
β-strand	29-32	4	3
β-strand	37-42	6	3
β-strand	51	1	1
α-helix	52-54	3
β-strand	56-61	6	3
β-strand	88-93	6	4
β-strand	100-104	5	4
β-strand	109-113	5	4
β-strand	116-120	5	4
β-strand	132-137	6	5
β-strand	144-148	5	5
β-strand	152-157	6	5
β-strand	169-175	7	5
β-strand	185-191	7	6
β-strand	194-199	6	6
β-strand	204-207	4	6
β-strand	218-222	5	6
β-strand	232-235	4	7
β-strand	238-242	5	7
β-strand	246-251	6	7
β-strand	256-261	6	7
β-strand	270-273	4	8
β-strand	280-284	5	8
β-strand	289-294	6	8
β-strand	298-301	4	8
α-helix	307-316	10
β-strand	330-338	9	2
β-strand	344-352	9	2
β-strand	366-372	7	2
α-helix	386-394	9
α-helix	412-415	4
α-helix	423-432	10
α-helix	434-442	9
α-helix	452-464	13
α-helix	466-468	3
α-helix	472-484	13
α-helix	488-490	3
β-strand	495-500	6	9
β-strand	503-508	6	9
α-helix	510-512	3
β-strand	518-520	3	10
β-strand	526-528	3	10
β-strand	529	1	11
β-strand	536	1	11
β-strand	542-544	3	12
β-strand	551-553	3	12
α-helix	555-557	3
α-helix	565-573	9
β-strand	577	1	13
α-helix	583	1
β-strand	584	1	13
α-helix	585	1
β-strand	586-587	2	12

Chain B: 8 helices, 37 β-strands

Element	Residues	Length	Sheet
α-helix	167-174	8
α-helix	178-191	14
α-helix	200-203	4
α-helix	223-225	3
α-helix	241-244	4
β-strand	253-258	6	14
β-strand	261-266	6	14
β-strand	270-272	3	15
α-helix	273-275	3
β-strand	283-287	5	15
β-strand	298-300	3	16
β-strand	310-318	9	16
β-strand	339-347	9	16
β-strand	353-361	9	16
β-strand	366-371	6	17
β-strand	383-388	6	17
β-strand	393-397	5	17
β-strand	407-409	3	16
β-strand	416-418	3	17
β-strand	425-430	6	18
β-strand	435-440	6	18
β-strand	444-449	6	18
β-strand	452	1	18
β-strand	458-461	4	18
β-strand	467-473	7	19
β-strand	481-486	6	19
β-strand	490-494	5	19
α-helix	496-498	3
α-helix	499-502	4
β-strand	504-508	5	19
β-strand	517-520	4	20
β-strand	525-529	5	20
β-strand	534-539	6	20
β-strand	547-551	5	20
β-strand	556-560	5	21
β-strand	567	1	22
β-strand	569-572	4	21
β-strand	576-578	3	21
β-strand	581	1	22
β-strand	601-604	4	21
β-strand	606	1	14
β-strand	613-616	4	14
β-strand	645-647	3	15
β-strand	656-660	5	15
β-strand	665-670	6	15

Chain C: 18 helices, 41 β-strands

Element	Residues	Length	Sheet
α-helix	4	1
β-strand	5	1	23
α-helix	6	1
β-strand	7-10	4	24
β-strand	21-23	3	25
β-strand	29-31	3	25
β-strand	38-42	5	25
β-strand	51	1	23
α-helix	52-54	3
β-strand	56-60	5	25
α-helix	73-74	2
β-strand	88-93	6	26
β-strand	100-104	5	26
β-strand	109-112	4	26
β-strand	117-120	4	26
β-strand	132-137	6	27
β-strand	144-148	5	27
β-strand	152-157	6	27
β-strand	169-175	7	27
β-strand	185-191	7	28
β-strand	194-199	6	28
β-strand	204-207	4	28
α-helix	216-217	2
β-strand	218-222	5	28
β-strand	231-235	5	29
β-strand	238-242	5	29
β-strand	246-251	6	29
β-strand	256-261	6	29
β-strand	269-273	5	30
β-strand	280-284	5	30
β-strand	289-294	6	30
β-strand	298-301	4	30
α-helix	307-316	10
β-strand	330-338	9	24
β-strand	344-352	9	24
β-strand	365-372	8	24
α-helix	386-394	9
α-helix	412-415	4
α-helix	423-432	10
α-helix	434-442	9
α-helix	452-464	13
α-helix	466-468	3
α-helix	472-484	13
β-strand	495-500	6	31
β-strand	503-508	6	31
α-helix	510-512	3
β-strand	518-520	3	32
β-strand	526-528	3	32
β-strand	529	1	33
β-strand	536	1	33
β-strand	542-544	3	34
β-strand	551-553	3	34
α-helix	555-557	3
α-helix	565-573	9
β-strand	577	1	35
α-helix	583	1
β-strand	584	1	35
α-helix	585	1
β-strand	586-587	2	34

Chain D: 8 helices, 39 β-strands

Element	Residues	Length	Sheet
α-helix	170-174	5
α-helix	178-191	14
α-helix	200-203	4
α-helix	223-225	3
α-helix	241-244	4
β-strand	253-258	6	36
β-strand	261-266	6	36
β-strand	270-272	3	37
α-helix	273-275	3
β-strand	283-287	5	37
β-strand	298-300	3	38
β-strand	310-318	9	38
β-strand	339-347	9	38
β-strand	353-361	9	38
β-strand	366-371	6	39
β-strand	383-388	6	39
β-strand	393-397	5	39
β-strand	407-409	3	38
β-strand	416-418	3	39
β-strand	425-430	6	40
β-strand	435-440	6	40
β-strand	444-449	6	40
β-strand	452	1	40
β-strand	458-461	4	40
β-strand	467-473	7	41
β-strand	481-486	6	41
β-strand	490-494	5	41
α-helix	496-498	3
α-helix	499-502	4
β-strand	504-508	5	41
β-strand	517-520	4	42
β-strand	525-529	5	42
β-strand	534-539	6	42
β-strand	547-551	5	42
β-strand	556-560	5	43
β-strand	567	1	44
β-strand	569-572	4	43
β-strand	576-578	3	43
β-strand	581	1	44
β-strand	600	1	45
β-strand	601-604	4	43
β-strand	606	1	36
β-strand	613-616	4	36
β-strand	622	1	45
β-strand	645-647	3	37
β-strand	656-660	5	37
β-strand	665-670	6	37

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hypothetical protein YPL007C	A, C	protein	588	SACCHAROMYCES CEREVISIAE	Q12308 (AlphaFold model)
YDR362CP	B, D	protein	524	SACCHAROMYCES CEREVISIAE	Q06339 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>2J04_1 HYPOTHETICAL PROTEIN YPL007C (chains A, C)
MKLLKDLLVDRKEFEDWKNNLTWARDGTLYLTTFPDISIGQPKYAKDINCNSKNLFHVKE
FPLEFENKLDFELAQQNGLLNSQPVCYPRVCKPSPIDDWMAVLSNNGNVSVFKDNKMLTN
LDSKGNLSSRTYHCFEWNPIESSIVVGNEDGELQFFSIRKNSENTPEFYFESSIRLSDAG
SKDWVTHIVWYEDVLVAALSNNSVFSMTVSASSHQPVSRMIQNASRRKITDLKIVDYKVV
LTCPGYVHKIDLKNYSISSLKTGSLENFHIIPLNHEKESTILLMSNKTSYKVLLEDELHV
TADNIIAPYLEKKFKKWSTIWNEFNNYETTLVIHGISLSPDGYSIAIVYDMERVAFKYKI
ASEQSFNIMFAPLYHTWTISERAVGLAWYQTYQIYNQSLPKLPENFSMNKKLLNGNYPIS
LDFQSYLNALMKSEEMRIIMFLNMTIDKPSILSFLEALYEYAINKKSELTNSFDLACVLS
IAAILKREAPIYNGTLLMKNSFLEETFNLESFTADPETVTSTTNNTWKRCGVTLLPILTT
HVKICPVSKQRVIDIKRDDLNDYGWFTRGLLERFNEISVYCGTTLEVM

Sequence of entity 2 (B, D), FASTA

>2J04_2 YDR362CP (chains B, D)
MGLLKDLSSARDKIERIYGLNKEKLLLLAKVKEGFETSVFDFPFKNIQPDSPYFVCLDPP
CKKESAYNKVIGDKNRTVYHEINKTEFENMIKLRTKRLKLLIGEVDAEVSTGDKIEFPVL
ANGKRRGFIYNVGGLVTDIAWLNIEENTDIGKDIQYLAVAVSQYMDEPLNEHLEMFDKEK
HSSCIQIFKMNTSTLHCVKVQTIVHSFGEVWDLKWHEGCHAPHLVGCLSFVSQEGTINFL
EIIDNATDVHVFKMCEKPSLTLSLADSLITTFDFLSPTTVVCGFKNGFVAEFDLTDPEVP
SFYDQVHDSYILSVSTAYSDFEDTVVSTVAVDGYFYIFNPKDIATTKTTVSRFRGSNLVP
VVYCPQIYSYIYSDGASSLRAVPSRAAFAVHPLVSRETTITAIGVSRLHPMVLAGSADGS
LIITNAARRLLHGIKNSSATQKSLRLWKWDYSIKDDKYRIDSSYEVYPLTVNDVSKAKID
AHGINITCTKWNETSAGGKCYAFSNSAGLLTLEYLSLEHHHHHH

Primary citation

Structure of the Tau60/Deltatau91 Subcomplex of Yeast Transcription Factor Iiic: Insights Into Preinitiation Complex Assembly. Mylona, A., Fernandez-Tornero, C., Legrand, P. et al. Mol Cell (2006) 24:221. DOI 10.1016/J.MOLCEL.2006.08.013 · PubMed

Other PDB entries of the same protein (UniProt Q12308 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9GC3 2.46 Å, yeast TFIIIC TauB subcomplex bound to a tRNA gene
8FFZ 3.8 Å, TFIIIA-TFIIIC-Brf1-TBP complex bound to 5S rRNA gene

Browse structure collections

About this viewer

MolViewer shows 2J04 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.