2JD4: Mouse laminin alpha1 chain, domains LG4-5

Mouse laminin alpha1 chain, domains LG4-5. Determined by X-ray diffraction at 1.9 Å resolution. Released 27 Feb 2007.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: MUS MUSCULUS
Chains: 2
Atoms: 6,115
Mol. weight: 84.01 kDa
Ligands: MG
Released: 27 Feb 2007

Explore 2JD4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JD4 contains 17 α-helices and 74 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 37 β-strands

Element	Residues	Length	Sheet
α-helix	2685-2687	3
β-strand	2694	1	1
β-strand	2699-2700	2	2
β-strand	2708-2712	5	3
β-strand	2721-2730	10	2
β-strand	2735-2741	7	3
β-strand	2748-2754	7	3
β-strand	2757-2763	7	3
β-strand	2768-2772	5	3
β-strand	2783-2790	8	2
β-strand	2793-2798	6	2
β-strand	2801-2802	2	2
α-helix	2803-2805	3
β-strand	2806-2807	2	2
α-helix	2808-2809	2
β-strand	2820-2823	4	3
β-strand	2841	1	3
α-helix	2842	1
β-strand	2844-2851	8	2
β-strand	2854-2855	2	2
β-strand	2863-2865	3	3
β-strand	2868	1	2
α-helix	2869-2870	2
β-strand	2871	1	1
β-strand	2874-2875	2	4
β-strand	2878-2893	16	5
β-strand	2896	1	6
β-strand	2899-2907	9	5
β-strand	2912-2918	7	5
β-strand	2924-2930	7	5
β-strand	2933-2939	7	5
β-strand	2944-2949	6	5
α-helix	2956-2958	3
β-strand	2963-2970	8	5
β-strand	2973-2978	6	5
β-strand	2981-2985	5	5
β-strand	2995	1	6
β-strand	2999-3003	5	5
α-helix	3019	1
β-strand	3020	1	5
α-helix	3021	1
β-strand	3022-3030	9	5
β-strand	3037-3038	2	5
α-helix	3041-3043	3
β-strand	3046-3051	6	5
β-strand	3055-3056	2	4

Chain B: 8 helices, 37 β-strands

Element	Residues	Length	Sheet
α-helix	2689-2692	4
β-strand	2694	1	7
β-strand	2699-2700	2	8
β-strand	2708-2712	5	9
β-strand	2721-2730	10	8
β-strand	2735-2741	7	9
β-strand	2748-2754	7	9
β-strand	2757-2763	7	9
β-strand	2768-2776	9	9
β-strand	2783-2790	8	8
β-strand	2793-2798	6	8
β-strand	2801-2802	2	8
α-helix	2803-2805	3
β-strand	2806-2807	2	8
α-helix	2808-2809	2
β-strand	2820-2823	4	9
β-strand	2841	1	9
α-helix	2842	1
β-strand	2844-2851	8	8
β-strand	2854-2855	2	8
α-helix	2856	1
β-strand	2863-2865	3	9
β-strand	2868	1	8
β-strand	2871	1	7
β-strand	2874-2875	2	10
β-strand	2878-2893	16	11
β-strand	2896	1	12
β-strand	2898-2906	9	11
β-strand	2912-2918	7	11
β-strand	2924-2930	7	11
β-strand	2933-2939	7	11
β-strand	2944-2949	6	11
β-strand	2963-2970	8	11
β-strand	2973-2978	6	11
β-strand	2981-2986	6	11
β-strand	2995	1	12
β-strand	2999-3003	5	11
α-helix	3019	1
β-strand	3020	1	11
α-helix	3021	1
β-strand	3022-3032	11	11
β-strand	3035-3038	4	11
α-helix	3041-3043	3
β-strand	3046-3051	6	11
β-strand	3055-3056	2	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Laminin subunit alpha-1	A, B	protein	383	MUS MUSCULUS	P19137

Sequence of entity 1 (A, B), FASTA

>2JD4_1 LAMININ SUBUNIT ALPHA-1 (chains A, B)
APLAQPELCAVDTAPGYVAGAHQFGLSQNSHLVLPLQQSDVRKRLQVQLSIRTFASSGLI
YYVAHQNQMDYATLQLQEGRLHFMFDLGKGRTKVSHPALLSDGKWHTVKTEYIKRKAFMT
VDGQESPSVTVVGKATTLDVERKLYLGGLPSHYRARNIGTITHSIPACIGEIMVNGQQLD
KDRPLSASAVDRCYVVAQEGTFFEGSGYAALVKEGYKVRLDLQITLEFRTTSKNGVLLGI
SSAKVDAIGLEIVDGKVLFHVNNGAGRITATYQPRAARALCDGKWHTLQAHKSKHRIVLT
VDGNSVRAESPHTHSTSADTNDPIYVGGYPAHIKQNSLSSRASFRGCVRNLRLSRGSQVQ
SLDLSRAFDLQGVFPHSCPGPEP

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	4

Water and common crystallization additives (CL) are not listed.

Primary citation

Crystal Structure and Cell Surface Anchorage Sites of Laminin {Alpha}1Lg4-5. Harrison, D., Hussain, S.A., Combs, A.C. et al. J Biol Chem (2007) 282:11573. DOI 10.1074/JBC.M610657200 · PubMed

Other PDB entries of the same protein (UniProt P19137), best resolution first:

5MC9 2.13 Å, Crystal structure of the heterotrimeric integrin-binding region of laminin-111
8DMK 3.7 Å, Cryo-EM reveals the molecular basis of laminin polymerization and LN-lamininopathies

Browse structure collections

About this viewer

MolViewer shows 2JD4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.