Structure of pkb-beta (AKT2) complexed with the inhibitor a-443654. Determined by X-ray diffraction at 2.3 Å resolution. Released 13 Feb 2007.
Explore 2JDR in 3D Show helices and sheets RCSB PDB PDBe
2JDR contains 19 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 149-151 | 3 | |
| β-strand | 152-160 | 9 | 1 |
| β-strand | 165-171 | 7 | 1 |
| β-strand | 177-184 | 8 | 1 |
| α-helix | 185-190 | 6 | |
| α-helix | 194-206 | 13 | |
| β-strand | 212 | 1 | 2 |
| α-helix | 213-214 | 2 | |
| β-strand | 215-220 | 6 | 1 |
| β-strand | 224-230 | 7 | 1 |
| β-strand | 236 | 1 | 2 |
| α-helix | 237-244 | 8 | |
| α-helix | 249-268 | 20 | |
| β-strand | 272 | 1 | 3 |
| α-helix | 278-280 | 3 | |
| β-strand | 281-283 | 3 | 2 |
| β-strand | 289-291 | 3 | 2 |
| β-strand | 298 | 1 | 3 |
| β-strand | 307 | 1 | 4 |
| β-strand | 311-312 | 2 | 5 |
| α-helix | 314-316 | 3 | |
| α-helix | 320-322 | 3 | |
| β-strand | 327 | 1 | 4 |
| α-helix | 331-345 | 15 | |
| α-helix | 355-364 | 10 | |
| α-helix | 365-367 | 3 | |
| α-helix | 375-384 | 10 | |
| α-helix | 400-404 | 5 | |
| α-helix | 407-409 | 3 | |
| α-helix | 414-418 | 5 | |
| α-helix | 423-424 | 2 | |
| α-helix | 441-444 | 4 | |
| α-helix | 468-470 | 3 | |
| β-strand | 475-476 | 2 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10-11 | 2 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Rac-beta serine/threonine-protein kinase | A | protein | 342 | HOMO SAPIENS | P31751 (AlphaFold model) |
| Glycogen synthase kinase-3 beta | C | protein | 10 | HOMO SAPIENS | P49841 (AlphaFold model) |
>2JDR_1 RAC-BETA SERINE/THREONINE-PROTEIN KINASE (chains A) GAMDPKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTE SRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIV SALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATMKTFCGTPEYLAPE VLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSL LAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFD DEFTAQSITITPPDRYDSLGLLELDQREEQEMFEDFDYIADW
>2JDR_2 GLYCOGEN SYNTHASE KINASE-3 BETA (chains C) GRPRTTSFAE
| ID | Name | Formula | Copies |
|---|---|---|---|
| L20 | (2S)-1-(1H-indol-3-yl)-3-{[5-(3-methyl-1H-indazol-5-yl)pyridin-3-yl]oxy}propan-… | C24 H23 N5 O | 1 |
A Structural Comparison of Inhibitor Binding to Pkb, Pka and Pka-Pkb Chimera. Davies, T.G., Verdonk, M.L., Graham, B. et al. J Mol Biol (2007) 367:882. DOI 10.1016/J.JMB.2007.01.004 · PubMed
Other PDB entries of the same protein (UniProt P31751 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2JDR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.