Core binding factor beta. Determined by solution NMR. Released 5 Jul 1999.
Explore 2JHB in 3D Show helices and sheets RCSB PDB PDBe
2JHB contains 6 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-16 | 7 | |
| α-helix | 18-23 | 6 | |
| β-strand | 27-31 | 5 | 1 |
| α-helix | 34-36 | 3 | |
| α-helix | 38 | 1 | |
| α-helix | 42-52 | 11 | |
| β-strand | 57-59 | 3 | 1 |
| β-strand | 65-66 | 2 | 1 |
| β-strand | 96-104 | 9 | 1 |
| β-strand | 109-117 | 9 | 1 |
| β-strand | 122-129 | 8 | 1 |
| α-helix | 131-140 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein (core binding factor beta) | A | protein | 143 | Mus musculus | Q08024 (AlphaFold model) |
>2JHB_1 PROTEIN (CORE BINDING FACTOR BETA) (chains A) GSMPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQTRFQNACRDGRSEIAFV ATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLHR LDGMGCLEFDEERAQQEDALAQQ
Solution structure of core binding factor beta and map of the CBF alpha binding site. Huang, X., Peng, J.W., Speck, N.A. et al. Nat Struct Biol (1999) 6:624-627. DOI 10.1038/10670 · PubMed
Other PDB entries of the same protein (UniProt Q08024 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2JHB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.